(data stored in ACNUC7421 zone)

EMBL: CP002047.PE465

CP002047.PE465       Location/Qualifiers
FT   CDS_pept        complement(541329..542501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00465"
FT                   /product="sarcosine oxidase subunit beta"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03586"
FT                   /db_xref="GOA:D7C095"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7C095"
FT                   /protein_id="ADI03586.1"
FT                   /translation="MSFSAFRTVPTSADVVIIGGGVMGASTAFHLAEAGVHNIVVVERG
FT                   DLCCGSSGKPIGGVRAQFSDPLNIELGSRSLRAYQEFPHRPGADIRLDTVGYLFLLDSE
FT                   QQVSDFETGVELQNSLDVPSRMISPSEARRLCPYISTDGLMAAAYSPADGHARPGLVVQ
FT                   GYVRAAARAGVTFATHTAVSGIHTAGDRVSGVHTGHGSIACSTVICTAGAWSAQIGDMA
FT                   GINLPIRPVRRQLAFTAPLAPPAPRIPFTIDFASSGYFHNSDDGLLFGLADPDQEDGFD
FT                   TTWTPEWLELFRTVARHRAPALADMETVSGWAGLYENTPDHNALIGRSGELPNFLYAAG
FT                   FSGHGFLQAPAIGEVMRDLYLEREPFTDISPLSADRFRDGADFRPEAHVV"
     ttgtccttct ccgccttccg caccgttccg acctccgccg atgttgtgat catcggtggc        60
     ggcgtcatgg gtgcgagcac cgcgtttcac ctcgccgagg ccggggtgca caacatcgtc       120
     gtcgtcgagc gcggcgacct gtgctgcggc agctcgggca agccgatcgg tggcgtacgc       180
     gcccagttct ccgatccgct caacatcgag ctgggcagcc gcagcctccg tgcctaccag       240
     gagtttcccc accggcccgg cgccgacatc cggctcgaca ccgtcggcta cctcttcctg       300
     ctcgacagcg aacagcaggt gagcgacttc gagaccggcg tcgagctcca gaacagcctc       360
     gacgtgccga gccgtatgat cagcccctcc gaagcccggc gcctgtgtcc ctacatcagc       420
     accgacggcc tcatggccgc cgcgtactcc ccggccgacg ggcacgcccg ccccggactg       480
     gtcgtccagg ggtatgtgcg ggccgcggcc cgcgcgggcg tcaccttcgc cacccacacc       540
     gccgtctccg gcatccacac ggcgggggac cgcgtcagcg gggtgcacac cggccatggc       600
     agcatcgcct gctccaccgt catctgcaca gcgggagcct ggtcggcgca gatcggcgac       660
     atggccggca tcaacctccc gatccggccc gtgaggcggc agttggcgtt caccgcgcca       720
     ctcgcgccgc ccgccccgcg tatcccgttc accatcgact tcgcctcgtc cggctacttc       780
     cacaacagcg acgacgggct gctgttcggg ctggccgacc ccgatcagga agacggcttc       840
     gacaccacct ggaccccgga gtggctggag ctgttccgca ccgtcgcccg ccaccgcgcc       900
     ccggctctgg ccgatatgga gaccgtcagc ggatgggccg gcctgtatga gaacacgccg       960
     gaccacaacg cgctgatcgg ccgctccggg gagctgccca acttcctcta cgccgccggg      1020
     ttctccggcc acggcttcct tcaggcgccc gcgatcggcg aagtcatgcg cgacctgtac      1080
     ctggagcgcg agccgttcac cgacatctcc ccgctcagcg ccgaccggtt ccgcgacggc      1140
     gccgatttcc gccccgaagc ccatgtggtg tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page