(data stored in ACNUC7421 zone)

EMBL: CP002047.PE47

CP002047.PE47        Location/Qualifiers
FT   CDS_pept        complement(43263..43355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03168"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUH7"
FT                   /protein_id="ADI03168.1"
FT                   /translation="MGVVQETGPGVARVRPGDHVALFYVPSSGF"
     gtgggtgtcg tgcaggagac cggaccgggc gtcgcccggg tccgtcccgg tgaccacgtg        60
     gccctgttct acgtgcccag cagcggcttc tga                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page