(data stored in ACNUC7421 zone)

EMBL: CP002047.PE470

CP002047.PE470       Location/Qualifiers
FT   CDS_pept        complement(546382..547440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00470"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03591"
FT                   /db_xref="GOA:D7C0A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A0"
FT                   /protein_id="ADI03591.1"
FT                   /translation="MRLPYRPPPTPETTGDTALEIRGLRVEFSEPGHASATPAVDGLDL
FT                   TVRRGEIVALVGESGSGKTMTALSAIGLLPPGARVTGGRITLGEEDLATLPPKRMNRVR
FT                   GHRLAMLFQQPKAMLDPTCTVGSQVAEPLRLHRGLSRRQARARVVELLRDVGIPEPERR
FT                   ASAYAHQLSGGMAQRVMIAAALAADPAMMIADEPTTALDATVQAQILRLLRHKQRESGM
FT                   AVLLITHDLTIVTSIADRVAVMYAGRVVEEGSVREVFDAPEHPYTRALLKASLLQSEEG
FT                   KLFAIPGSATQSRALDHGCRFQPRCPLSQDLGIAGRCSGAEPPLHTCGGEHRCRCWASE
FT                   HGTELRGEAVGV"
     atgcgcctgc cataccgccc cccgccgacc cccgagacca ccggcgacac cgcgctggag        60
     atccggggcc tgcgggtgga gttctcagag cccggtcacg cttccgccac ccccgcggtc       120
     gacggcctcg acctgaccgt ccggcgcggc gagatcgtcg cgctggtcgg cgagtcgggc       180
     tccggcaaga ccatgacggc gctgagcgcc atcgggctgc tgccgcccgg cgcccgggtc       240
     accggcggcc ggatcaccct cggcgaggag gacctggcca ccctgccgcc gaagcggatg       300
     aaccgcgttc gcggccaccg gctcgccatg ctcttccagc agcccaaggc catgctcgac       360
     cccacctgca cggtggggag ccaggtcgcc gaaccgctcc ggctgcaccg agggctcagc       420
     cgccgccagg caagggcacg ggtcgtggaa ctcctgcgcg acgtcggcat ccccgaaccc       480
     gagcgcagag cctcggcgta cgcacaccag ctctccggcg gaatggccca gcgtgtgatg       540
     atcgcggcag ccctcgccgc cgaccccgcc atgatgatcg ccgacgagcc gaccaccgct       600
     ctcgacgcca ccgtccaggc ccagatcctg cggctgctcc gccacaagca gcgcgagtcc       660
     ggtatggccg tgctgctcat cacgcacgac ctcaccatcg tcacctcgat cgccgaccgg       720
     gtggccgtga tgtacgcggg gcgtgtggtg gaggagggat cggtacggga agtcttcgac       780
     gcccccgaac acccgtacac ccgcgccctg ttgaaggcat cgctgctcca gtccgaggag       840
     ggcaagctct tcgccatccc gggcagcgcg acacagtccc gcgctctgga ccacggatgc       900
     cggttccagc cccgatgtcc gctctcccag gacctgggga tcgccggccg gtgctcgggc       960
     gccgagccgc cactgcacac ctgcggtggt gaacaccgct gccgctgctg ggcgtccgag      1020
     cacggcaccg aactccgtgg cgaggcggtg ggcgtatga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page