(data stored in ACNUC7421 zone)

EMBL: CP002047.PE471

CP002047.PE471       Location/Qualifiers
FT   CDS_pept        complement(547454..548149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00471"
FT                   /product="transcriptional regulator protein"
FT                   /note="COG1802 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03592"
FT                   /db_xref="GOA:D7C0A1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A1"
FT                   /protein_id="ADI03592.1"
FT                   /translation="MPHDSTPAAPSATPVRRTTLAAQVVEQIRSRLLTGTFPPGSQLGE
FT                   AELAESLGVSRGPVREALARLVHEGLLLSEPHRGVFVPLLGEADVLDIYYAREALEAAA
FT                   FRRVITAPRPPGLLSALDETVDELARATRTGDWSKVADLDVRFHSLVIEAAGSPRLRRM
FT                   FDTVIAETRLCLNLQADADPARLDLVDEHRELARLIAGDDVAAALATLAQHFEEATVTV
FT                   RNRLRAVRR"
     atgcctcatg actccacgcc ggcggcaccg tcggctaccc cggtccgccg caccacgctc        60
     gccgcacagg tcgtggagca gatccggtcc cggctgctca ccggcacctt cccgcccggc       120
     tcccagctgg gcgaggccga actcgccgaa tcccttgggg tcagccgcgg cccggtgcgc       180
     gaggccctcg cccgcctcgt ccatgaggga ctgctgctga gcgagcccca tcgcggggtg       240
     ttcgtgccgc tgctcggcga ggccgacgtc ctcgacatct actacgccag ggaggcgctc       300
     gaggccgcgg ccttccgccg ggtcatcacc gcgcccagac cgcccggcct gctgtcggcc       360
     ctcgacgaga cggtggacga gctcgcccgt gccacgcgca cgggtgactg gtcgaaggtg       420
     gccgacctcg atgtgcggtt ccactccctg gtgatcgagg cggccggcag cccccgcctg       480
     cgccgcatgt tcgacaccgt gatcgccgag acccggctgt gtctcaacct ccaagccgat       540
     gccgaccccg cgcggctcga cctcgtcgac gaacaccggg agctggcgcg gctgatcgcg       600
     ggcgatgacg tcgccgccgc gctggccacc ctcgcccagc acttcgaaga agccaccgtg       660
     accgtgcgca accgccttcg cgcggtccga cgctga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page