(data stored in ACNUC7421 zone)

EMBL: CP002047.PE472

CP002047.PE472       Location/Qualifiers
FT   CDS_pept        complement(548139..549044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00472"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03593"
FT                   /db_xref="GOA:D7C0A2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A2"
FT                   /protein_id="ADI03593.1"
FT                   /translation="MALSSSLSRDPVPSTAPRRLAHLTATGLRAVTGRHWTLRIGAVVL
FT                   ALVLTVLLLTPWIAPYDPAHQDLGQRLSGPGAHHLLGTDQLGRDILSRLMYGGRFSVSI
FT                   AAVTLLLSAVIGTVIGAFSARRGGIVDEVVMRTTDLLISIPDVIVALFLIAAFGTGYGM
FT                   LIAALTIVGWTPFARLMRGLALEINSREYIEAAEALGCSKVFIVFRHVIPNALRPVLSL
FT                   GFLRFGHKLITVGGLSYVGLGVQPPDSDWGAMLLDAQPYMQRLPLLVIAPGAAIFVTAL
FT                   SVTLIGHGMELKRKRRTDAS"
     atggcgctgt ctagctctct ttcccgtgat cccgtaccct ccaccgcacc ccggcgcctc        60
     gcgcacctga ccgccaccgg tctgcgcgcg gtcaccggcc ggcactggac gctgcgcatc       120
     ggcgccgtcg tcctggccct ggtgctgacc gtcctgctgc tcaccccgtg gatcgcaccg       180
     tacgacccgg cccaccagga cctcggacag cggctgtccg ggcccggtgc ccaccatctg       240
     ctcggcacgg accagttggg ccgggacatt ctcagcaggc tgatgtacgg cgggcgcttc       300
     tcggtgtcca tcgcggcggt caccctgctg ctctccgccg tgatcggcac ggtgatcgga       360
     gccttcagcg cgcggcgcgg cgggatcgtg gacgaggtgg tcatgcgcac caccgatctg       420
     ctgatctcca tccccgatgt gatcgtcgcc ctgttcctga tcgcggcctt cggcacgggc       480
     tacggcatgc tcatcgcggc cctgaccatc gtcgggtgga cccccttcgc ccggctgatg       540
     cgcggcctgg ccctggagat caacagccgg gagtacatcg aggccgccga ggcgctgggc       600
     tgctccaagg tgttcatcgt cttccgccat gtcatcccca atgcactgcg gcccgtgctc       660
     tccctgggtt ttctgcggtt cggccacaag ctcatcaccg tcggcggact gtcgtacgtg       720
     gggctgggcg tgcagccgcc cgactccgac tggggcgcca tgctgctgga cgcccagccc       780
     tatatgcaac gcctcccgct gctggtgatc gcccccggcg ccgcgatctt cgtgacggcg       840
     ctgagcgtca ccctgatcgg ccacggcatg gaactgaagc gcaagaggag gacggatgcc       900
     tcatga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page