(data stored in ACNUC7421 zone)

EMBL: CP002047.PE473

CP002047.PE473       Location/Qualifiers
FT   CDS_pept        complement(549031..549978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00473"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03594"
FT                   /db_xref="GOA:D7C0A3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A3"
FT                   /protein_id="ADI03594.1"
FT                   /translation="MVRFIVRRLLVLLITLLAVSAATFAIPYASGGDPVRTILRSRVSD
FT                   QALDPSAIAALRSELGLDRPILVQYLSWLGRAVRGDFGMSFTSRTPVDQLLGTAIGVSG
FT                   TLAVIAIGLAFLAALPLGTLAAMRPGKRVDNGVTLLTQSFVAVPEYWLAPILVLVFSRY
FT                   LGWLPSAGWRDPTSIILPALTLALRPMAYFTQVTRAAMSDVLASPYMTAARSRGLSGGQ
FT                   ALLRHGLRNALLPVMTLFSLWFAGLLGGSVVVEVIFAIPGMGRLVYSAVVNHDVPLIQG
FT                   GILCTVALAVLITTVTDLLYALINPAVRVRDGAV"
     atggtcagat tcatcgtgcg gcggcttctg gtgctgctga tcaccctgct cgccgtatca        60
     gccgccacct tcgccatccc gtacgcctcg ggcggcgacc ccgtccggac gatcctgcgg       120
     tccagagtct ccgaccaggc cctcgacccc tcggcgatcg cggccctgcg ctccgagctc       180
     gggctcgacc ggccgatcct cgtgcagtat ctgagctggc tcggccgggc ggtgcgtggg       240
     gacttcggga tgtccttcac cagccgcacc ccggtcgacc aactgctggg caccgccatc       300
     ggcgtgtccg gcaccctggc cgtcatcgcc atcgggctgg ccttcctcgc ggccctgccc       360
     ctgggcacgc tcgccgcgat gcggccgggg aaacgggtcg acaacggagt gaccctgctg       420
     acgcagagct tcgtcgccgt ccccgaatac tggctggccc ccatcctggt gctggtcttc       480
     tcccgctacc tcggctggct gccctcggcc ggatggcgcg acccgacctc catcatcctg       540
     cccgccctca ccctcgccct gcggcccatg gcctacttca cccaggtcac cagagcggcg       600
     atgagcgatg tcctggcatc gccgtacatg accgccgccc gcagccgggg actgagcgga       660
     ggccaggccc tgctgcggca cgggctgcgc aacgcactgc tgccggtgat gacgctgttc       720
     tccctgtggt tcgcggggct gctcggcgga tcggtggtcg tggaggtcat cttcgccatc       780
     cccggaatgg gccggctcgt ctacagcgcc gtggtcaacc acgatgtccc gctgatccag       840
     ggcggaatcc tgtgcaccgt ggcgctggcg gtcctgatca ccaccgtgac cgaccttctg       900
     tacgcactga tcaacccggc cgtgagggta cgcgatggcg ctgtctag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page