(data stored in ACNUC7421 zone)

EMBL: CP002047.PE474

CP002047.PE474       Location/Qualifiers
FT   CDS_pept        complement(550024..551301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00474"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03595"
FT                   /db_xref="GOA:D7C0A4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A4"
FT                   /protein_id="ADI03595.1"
FT                   /translation="MKTVPYWLDTAPPGPDRSAAEVGGRTDVAIVGAGLTGLSAALHLA
FT                   RKGAQVTVLEQESVGWGASGRNGGMCTTGLAIGFLTAVQRYGIPTAKAAYLAYNEAIDT
FT                   VEKLVVEEEIDCDFSRTGKLNLAAKPAHYERLARTHEALADLIGYPTQLIPKKDIRSEV
FT                   GSDHYHGAMADPQGAGLHVGKFVRGLAEAAAAQGVRILEKAPVTRARRVSGTAHDLTTP
FT                   VGTLRADQVLVATSGYTGSPFRWLRNRIIPVGSFIIVTEPLRQEVVDELMPTRRMASDS
FT                   KNILYYFRITPDNRLLFGGRARFAMSNPQSDRKSGQILRKGMLSVFPQLDGVRIDYLWG
FT                   GLVDISLDQMVHSGERDGLFYSVGYSGHGVQMATHMGRQMADVMDGRPEANIWRGMKFP
FT                   RVPGHFGPPWFLPFAGAYYRALDIIK"
     gtgaaaaccg ttccgtactg gctggacacg gccccgcccg gccccgaccg cagcgcggcg        60
     gaggtcggtg gccgcaccga tgtggcgatc gtgggggccg ggctgaccgg actgtccgcc       120
     gcgctgcacc tggcccgtaa gggcgcccag gtcaccgtac tggagcagga gagcgtgggc       180
     tggggagcgt cggggcgcaa cggtggcatg tgcaccacgg ggctggccat cggcttcctc       240
     accgccgtgc agcgctatgg catcccgacc gccaaggcgg cgtacctggc ctacaacgag       300
     gccatcgaca ccgtcgagaa gctggtggtg gaggaggaga tcgactgcga cttctcccgc       360
     accggaaagc tcaacctggc cgccaagccc gcgcactacg agcggctggc ccgcacccat       420
     gaagcactcg ccgacctgat cggctacccc acgcagctga tccccaagaa ggacatcagg       480
     tccgaggtcg gatccgacca ctaccacggc gcgatggcgg accctcaggg cgccgggttg       540
     cacgtgggca agttcgtccg cggtctggcc gaggccgccg ccgctcaggg ggtgcggatc       600
     ctcgagaagg ccccggtcac cagggcccgc cgggtcagcg gtacggcgca cgatctgacc       660
     accccggtcg gcaccctccg cgccgatcag gtgctggtcg ccacgagcgg ctacaccggg       720
     tccccgttcc gctggctgcg caaccggatc atccccgtcg gcagtttcat catcgtcacc       780
     gaaccgcttc ggcaggaggt ggtcgacgag ctcatgccca cccgccggat ggcctccgac       840
     tccaagaaca tcctgtacta cttccgcatc acccccgaca accggctgct gttcggcggc       900
     cgggcgcggt tcgccatgtc caatccccag tccgaccgga agagcggaca gattctgcgc       960
     aaggggatgc tctcggtgtt cccgcagctc gacggcgtgc gcatcgacta tctgtggggc      1020
     ggtctcgtcg acatcagcct cgaccagatg gtgcactccg gcgagcggga cggtctgttc      1080
     tactccgtcg gctactcggg ccacggggtc cagatggcca cccacatggg ccggcagatg      1140
     gccgatgtca tggacggccg acccgaggcg aacatctggc gcggcatgaa gttcccacgt      1200
     gttcccggac acttcgggcc gccctggttc ctgccgttcg ccggggccta ctaccgggcc      1260
     ctcgacatca tcaagtag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page