(data stored in ACNUC7421 zone)

EMBL: CP002047.PE476

CP002047.PE476       Location/Qualifiers
FT   CDS_pept        complement(552017..553486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00476"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03597"
FT                   /db_xref="GOA:D7C0A6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A6"
FT                   /protein_id="ADI03597.1"
FT                   /translation="MGGQTSSGGGATGARSIVVDEPFAPAANWALETDDSFVLSKAGCL
FT                   ETLVKYQTGGGIKPMLAASWKQTRPTTWDFTLRPGVTFQDGTPLDAKAVAGALKHALAA
FT                   KTPAPGFSPETIAAVTAVDGSTVRITTPAPDALLPYRLAAPNTGILAPKAYTGSSTNPE
FT                   GTCTGPFRITKEIPQQAIQLKRNPKYWNGPVKLASAEVRFIADGAKRATQIQTGEAQIS
FT                   RKLPVPSVQDLKGNSSVEVLTEQLPRTTELVLNNKKAPFDNEKVRQAFQAAIDTKAITN
FT                   AVYQGAGQQAVGPFGPGEPWTPDGAAPVKADPAKAKALLSEAGVKPESIKVSLIAYNEG
FT                   SGFSDLAAIIQQELKAIGVKASIRTADYASVEPDLLSGDFDAALLSRNHLGDMPDPLGY
FT                   LTADYTCKGSYNLSHYCDPKTDGLIKKAASAKDPDTRYADYAKVAAELQSRAVDVFLVH
FT                   ETESVAVASGLKGFAVHPYYTLTANLSLGTK"
     atgggcggcc agacctccag cggcggcggc gcaacaggcg ctcggtccat cgtggtcgac        60
     gaaccgttcg cgccggccgc caactgggcc ctggagaccg acgactcctt cgtcctcagc       120
     aaggcgggct gcctggagac cctggtgaag taccagacgg gtggcgggat caaaccgatg       180
     ctcgccgcct cctggaaaca gacccgcccg acgacctggg acttcaccct ccgcccggga       240
     gtgacattcc aggacggcac cccgctcgac gcgaaagcgg tggccggggc cctgaaacac       300
     gcgctcgccg cgaagactcc ggcccccggc ttctcgcccg agacgatcgc cgcagtcaca       360
     gcggtggacg gctcgaccgt gcggatcacc acccccgccc ccgacgccct gctgccctac       420
     cggctcgccg cccccaacac cggaatcctt gccccgaagg catacaccgg atcgtcgacc       480
     aaccccgaag gaacgtgtac cggtccgttc cgtatcacca aggaaatccc ccaacaggca       540
     atccagctca agcgcaaccc gaagtactgg aacggcccgg tgaagctggc ctccgccgag       600
     gtacggttca tcgcggacgg cgccaaacgg gccacccaga tacagaccgg ggaagcccag       660
     atatccagaa agctccccgt cccgagcgtc caggacctca agggcaactc ctccgtcgag       720
     gtgctgaccg aacaacttcc ccgaaccacg gaactcgtcc tcaacaacaa aaaagccccc       780
     ttcgacaatg agaaggtgcg gcaggcgttc caggcggcga tcgacaccaa ggcgatcacc       840
     aacgccgtct accagggagc ggggcagcag gccgtcggcc cgttcggccc cggagaaccc       900
     tggacacccg acggggccgc cccggtgaag gccgacccgg ccaaggccaa ggccctgctc       960
     tccgaggccg gggtgaagcc cgagtcgatc aaagtgtccc tgatcgccta caacgaggga      1020
     tcgggcttct ccgatctcgc cgccatcatc cagcaggaac tcaaggccat cggcgtgaag      1080
     gcgagcatcc gcaccgccga ctacgcctcg gtggaacccg acctgctctc cggcgacttc      1140
     gatgccgccc tgctctcccg caaccacctc ggcgacatgc ccgacccgct gggctatctg      1200
     accgcggact acacctgcaa gggcagctac aacctctcgc actactgcga tccgaagacc      1260
     gacggcctca tcaagaaggc agcgtccgcg aaggaccccg acacgcgcta cgccgactac      1320
     gccaaggtcg cggcggagct ccagtcccgc gccgtggatg tcttcctcgt ccacgagacc      1380
     gagtccgtcg ccgtcgcctc cggcctcaag ggcttcgccg tccacccgta ctacaccctc      1440
     accgcgaacc tctccctcgg cacgaagtaa                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page