(data stored in ACNUC7421 zone)

EMBL: CP002047.PE477

CP002047.PE477       Location/Qualifiers
FT   CDS_pept        complement(553869..554825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00477"
FT                   /product="cation efflux system protein"
FT                   /note="COG0053 Predicted Co/Zn/Cd cation transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03598"
FT                   /db_xref="GOA:D7C0A7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A7"
FT                   /protein_id="ADI03598.1"
FT                   /translation="MVKPHSHEAADKVDSAMESSAEGMRALWLSLAILGATAVFQTVVV
FT                   LISGSVALLGDTIHNFADAMTALPLGVAFVLGRRVANRTFTYGYGRAEDLAGIVIVLTI
FT                   AASAALAAYEAIDRLMNPRDISHLGIVSIAAVVGFIGNEWVARYRIRVGRKIGSAALVA
FT                   DGLHARTDGFTSLAVLLGAGGAALGWQLADPIVGLLITAAILLVLKDATREVFRRLMDS
FT                   VDPTLVDKGEAAVREVPGVRDVSELRMRWIGHKLRAEATVEVDGGLSVRESHAVAVDVE
FT                   HALIHAVPRLTAALVHTDPALGPDADDPHLALAHHMT"
     atggtgaagc cgcactcgca cgaggcggcg gacaaggtcg actccgcgat ggagtcgtcc        60
     gccgagggta tgcgcgccct ctggctgtcc ctggcgatcc tgggcgccac cgcggtgttc       120
     cagaccgtgg tcgtcctcat ctccggttcg gtggcgctgc tgggcgacac catccacaac       180
     ttcgccgacg cgatgaccgc acttccgctc ggcgtggcct tcgtcctcgg gcggcgtgtg       240
     gcgaaccgta cgttcaccta tggctacggg cgggccgagg atctggccgg aatcgtcatc       300
     gtcctgacca tcgccgcctc ggcggcactg gccgcctatg aggccatcga ccggctgatg       360
     aatccgcgcg acatctccca tctgggcatc gtctcgatcg cggcggtcgt cggcttcatc       420
     ggcaatgaat gggtggcccg ctaccggatc cgggtcgggc ggaagatcgg ctcggcggcc       480
     ctggtcgccg acggactgca tgcccgcacc gacggcttca cctctctcgc cgtgctgctg       540
     ggcgccggcg gcgccgcgct cggctggcag ctcgccgacc cgattgtcgg cctgctcatc       600
     acggctgcga tcctgctcgt cctcaaggac gcgacacgcg aggtcttccg ccgcctgatg       660
     gactccgtcg accccaccct cgtcgacaag ggcgaggccg cggtgcgcga ggttcccggg       720
     gtgcgcgacg tgagtgagct gaggatgcgc tggatcgggc acaagctgcg cgccgaggcc       780
     acggtcgagg tggacggagg gctgagcgta cgggagtcgc atgccgtggc ggtcgacgtc       840
     gagcatgcgc tgattcacgc ggtgccccgg ctgaccgccg ccctggtgca caccgacccg       900
     gctctcgggc cggacgcgga cgaccctcat ctggcgctcg cccaccacat gacatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page