(data stored in ACNUC7421 zone)

EMBL: CP002047.PE478

CP002047.PE478       Location/Qualifiers
FT   CDS_pept        complement(555178..556629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00478"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03599"
FT                   /db_xref="GOA:D7C0A8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A8"
FT                   /protein_id="ADI03599.1"
FT                   /translation="MVEVLVPHLTDLFGNPSSNHPYGAEPGRRWPSPGHRSPLRDATAP
FT                   PTATGRDMTRPAPDADTTGPISDTPDTPETTHTAQAQRRILRVLVASQILSGAGLAAGV
FT                   TVGALLAQDMLGTSSLAGLPSGLFTAGSALAAVAVGRISQARGRRPGLATGYLTGAIGS
FT                   AGVITAAVLDTSVLLFIALFVYGAGTATNLQARYAGADLAQPNHRARAVSTVLVATTLG
FT                   GVAGPNLAAPTGDLAETLGIPHLAGPFMLGGAAYALAALVLAIWLRPDPLLTARTLAAA
FT                   EQSSNSATDTSPATDAAHERRGGVVLGALVMILTQLVMVAIMTMTPVHMHDHGHGTAAS
FT                   GLVIAIHIGAMYLPSPITGRLVDRYGPPKIAAASGLTLLAAGILAATAPGDSVALLALA
FT                   LALLGLGWNFGLVSGTAIITDTVPLATRAKTQGTVDVSIAIAGATGGLSSGIVVATASY
FT                   PILALTGGVLALAILPAIAATASSR"
     gtggtcgagg tgttggtgcc gcacctgacg gacctcttcg gcaacccctc cagcaaccac        60
     ccctacggcg ccgagcccgg caggcgctgg ccgagccccg ggcacaggtc gccgctccga       120
     gacgccaccg ccccacccac cgccaccgga agagacatga ccagacccgc accagacgcc       180
     gacaccacgg gcccgatatc cgacaccccc gacacccccg agaccaccca caccgcccag       240
     gcacagcgcc gcatcctgcg cgtcctggtc gcctcccaga tcctcagcgg ggccggactc       300
     gccgccggtg tcaccgtcgg cgcgctgctg gcccaggaca tgctcggcac cagcagcctc       360
     gccgggctgc ccagcggcct gttcaccgcc gggtccgcac tcgccgccgt cgccgtcggt       420
     cgcatctccc aagcccgcgg acgccgcccc ggcctggcca ccggctatct caccggagcc       480
     atcggcagcg ccggagtcat caccgccgcc gttctggaca cctccgtcct gttgttcatc       540
     gccctgttcg tctatggagc cggtaccgcc accaacctcc aggcccgcta cgccggagcc       600
     gaccttgccc agccgaacca ccgcgcccgc gccgtgtcca ccgtcctggt cgccaccacc       660
     ctcggcggcg tcgccggccc gaacctcgcc gcacccaccg gcgacctcgc ggaaaccctc       720
     ggcatccccc acctggccgg ccccttcatg ctgggcggtg ccgcctacgc cctggccgcg       780
     ctcgtcctcg ccatctggct gcgacccgac ccgctgctca cggcccgcac cctcgccgcc       840
     gccgaacagt ccagcaactc cgccaccgat acgtccccag ccaccgacgc cgcacacgaa       900
     cgccgcggag gcgtggtcct cggcgcgctc gtcatgatcc tcacccagct cgtcatggtc       960
     gcgatcatga cgatgacccc ggtccatatg cacgaccacg gccatggcac cgccgcctca      1020
     ggcctcgtca tcgccatcca catcggcgcc atgtacctgc cctcaccgat cacaggccgg      1080
     ctcgtcgacc gctacggccc gccgaagatc gccgccgcgt ccggcctcac cctcctggcc      1140
     gccggcatcc tcgccgccac cgcccccggc gactccgtcg ccctcctcgc gctcgccctg      1200
     gccctgctcg gcctcggctg gaacttcggc ctcgtctccg gcacggcgat catcaccgac      1260
     accgtgccac tcgccacccg cgccaagacc cagggaacgg tcgacgtctc catcgccatc      1320
     gcgggcgcca ccggcggctt gtcctccggc atcgtcgtcg ccaccgccag ctaccccatc      1380
     ctcgcgctca cgggtggcgt cctcgccctc gcgatcctgc ccgccatcgc cgcgaccgcg      1440
     agcagccgat ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page