(data stored in ACNUC7421 zone)

EMBL: CP002047.PE480

CP002047.PE480       Location/Qualifiers
FT   CDS_pept        complement(557516..558466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00480"
FT                   /product="ycaO protein"
FT                   /note="COG1944 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03601"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B0"
FT                   /protein_id="ADI03601.1"
FT                   /translation="MRREWTHHPFATSTNGLASGNSTAEAALHALYEVIERDAVARLTT
FT                   LPRAERPRLDLPSVDDPDCAELLDRFGAAGVSVTAFDATWPPGEGGTGVPCYHVSVWSP
FT                   DLPVVVPGSGCHGAPEVALARALTEAAQGRLTVISGSRDDLSDRLYALQADPAKGAPRL
FT                   APSLRTVPLRPRETGHDLAEESRTVAAGVTTLTGTEPVLVEPGRPAGDARVCGGPGPRL
FT                   LLGPRRTARRPDAGTAARDPGLGVRPADRGPGPAAQPRAEPARLSRLPGLLRPAAHLLH
FT                   GALGHRSVRQRDPVLPLARLKTVEPFALRERELQR"
     gtgcgccggg agtggaccca ccaccccttc gcaacttcca ccaacggcct ggccagcggg        60
     aattcaacgg cggaggcggc ccttcacgcg ctgtacgagg tgatcgaacg ggacgccgtg       120
     gcgcggctga ccacactgcc cagggccgaa cgcccccgtc tcgacctgcc ctccgtggac       180
     gaccccgact gcgcggaact gctcgaccgc ttcggcgcag cgggtgtctc cgtcaccgcg       240
     ttcgacgcga cctggccgcc cggcgagggc ggcaccggcg ttccgtgcta ccacgtgagc       300
     gtctggtcgc ccgatctgcc ggtcgtcgtg cccggatccg gctgccacgg cgcgcccgag       360
     gtggcgctag cccgcgcgct caccgaggcc gctcagggac ggctcaccgt gatcagcggt       420
     tccagggacg atctcagcga ccggctctac gctctccagg cggacccggc gaagggcgcc       480
     cctcggttgg caccgtcgtt gcggaccgtg cccctccggc ctcgggagac gggccacgat       540
     ctcgccgagg agtcgcgtac cgtcgcggcg ggcgtcacca ccctcaccgg caccgagccg       600
     gtgttggtcg agcccggtcg gcctgcgggc gacgcccgag tctgcggcgg ccctggtccg       660
     cggcttctgc tgggcccccg gcgtaccgcc cgacgacctg atgctggaac tgctgcgcgc       720
     gaccccggcc tgggtgtgcg cccagcggat cgtggtccgg gccctgcggc tcaaccgcga       780
     gctgagccgg ctcggctatc ccgtctcccg ggtctcctcc gcccggctgc acacctactt       840
     cacggagcgc tggggcaccg atcagttcga cagcgcgatc ctgtcctccc gctggcgcgg       900
     ctgaaaaccg tcgaaccctt tgccctgcgc gagcgcgaac ttcagaggtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page