(data stored in ACNUC7421 zone)

EMBL: CP002047.PE481

CP002047.PE481       Location/Qualifiers
FT   CDS_pept        complement(558527..559732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00481"
FT                   /product="hypothetical protein"
FT                   /note="COG5520 O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03602"
FT                   /db_xref="GOA:D7C0B1"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B1"
FT                   /protein_id="ADI03602.1"
FT                   /translation="MAATPAVGASAAAATVIVDPSAVRQTIRGFGGMNHTVWISDLTPA
FT                   QRDTAFGNGEGQLGFSVLRIPVHENRADWSREVATAKRAIEYGAAVIASPWNPPAQMVE
FT                   TFVHGDQSNAKRLRYDMYGAYAQHLNDFCRFMKDNGVSLYAISVQNEPDYAHDWTWWTP
FT                   TEMIRFLRENAGSIEIKVIAPESFQYVKSFSDPILNDPTALANLDILGAHLYGTPYQNF
FT                   PYPLFKEKGRGKELWMTEVYYPNSSDSADLWPQALDVAEHIHHALVDAEFQAYVWWYIR
FT                   RSYGPMREDGRISKRGATMAHFSKFVRPGYVRIDATSNPQSNLYVLAYKGGDSKVVIIA
FT                   INKGTSSVSQPFTLVNNTSSSVSSWLTDASRNLASLGAMSVSNGSFTGQLPARSVTTFV
FT                   TG"
     gtggccgcga cgcctgccgt gggggcatcc gcggcggctg ccactgtgat cgtcgacccg        60
     tcggccgtgc ggcagacgat ccggggcttc ggtggtatga accacacggt ctggatcagc       120
     gatctgacac ctgcccagag agacacggca ttcggcaacg gcgaggggca gcttgggttt       180
     tccgtgctga gaatccccgt tcacgagaac cgagcggact ggagccgcga ggtggcgacg       240
     gcgaagcgtg cgatcgagta cggggcggcc gtcatcgcgt cgccgtggaa tccccccgct       300
     cagatggtcg agaccttcgt ccacggcgat cagtccaacg caaagcggct ccggtacgac       360
     atgtacggcg cttatgcgca gcacctgaac gacttctgca ggtttatgaa ggacaacggc       420
     gtgagcctgt acgccatctc ggtgcagaac gagcccgatt acgcgcatga ctggacgtgg       480
     tggactccga ccgagatgat ccgtttcctg cgcgagaacg ccggctcgat cgagatcaag       540
     gtgatcgcgc cggagtcctt ccagtatgtg aagagcttct cggatccgat tctcaacgac       600
     ccgacagcgc tcgccaacct ggatattctc ggggctcatc tctacggcac gccgtaccag       660
     aatttcccct accccctctt caaggaaaag ggcaggggca aagaactctg gatgaccgag       720
     gtctactatc ccaacagcag cgattcggcg gacctctggc cccaagcgct cgacgtggcg       780
     gaacatatcc accatgccct ggtggacgcc gagttccagg cgtatgtgtg gtggtacatc       840
     aggcgtagct acggccccat gagggaagac gggcgaatca gcaagcgcgg cgccaccatg       900
     gcgcacttct cgaaattcgt ccgcccggga tatgtgcgga tcgacgcgac ctcgaatccc       960
     cagtcgaacc tctacgtctt ggcgtacaag ggtggtgact ccaaagtggt catcatcgcc      1020
     atcaacaagg ggacctcgtc ggtgagccag ccgttcaccc tggtgaacaa cacctcgtcc      1080
     agtgtgtcgt cctggttgac ggacgcgagc agaaacctcg cgtctctggg cgcgatgagc      1140
     gtgtcgaacg gctccttcac gggccagctt cccgcgcgaa gcgtgacaac cttcgtgacc      1200
     gggtga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page