(data stored in ACNUC7421 zone)

EMBL: CP002047.PE482

CP002047.PE482       Location/Qualifiers
FT   CDS_pept        560309..562027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00482"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03603"
FT                   /db_xref="GOA:D7C0B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B2"
FT                   /protein_id="ADI03603.1"
FT                   /translation="MTVPAMLLPALGNIGINYIAPLIVAKLVARIADDSGVSIGSTLPY
FT                   VLGFVGVLLLAELLWRIGIHCLNRVDAHGIEHLYVIGMDELFAKDAAFFHDNFAGSLTK
FT                   RVLSFASRFEEFIDTLTFSVVGSLVPLVFASVVLWSYDPLLVVGLLAMIALTALCAAPL
FT                   IRRRQKLVDQREEAIARVAGHVADSLMNMDTVRAFAAEEREAAEHRSRVAESRRLSLRS
FT                   WDYGNLRIDTLVAPMSVLTNTLGLLLAVALGGGSHGVEAVVVAFTYYSNATRIMFEFNQ
FT                   IYRRLESSMTEAAQFTELLLTSPTVLDPESPEPLRSEGAGVRFEKVAFAHAGAETLFDG
FT                   LDLAVPSGTRVGLVGRSGGGKTTLTQLLLRTTDIEAGRILIGGQDISRLRQADLRSLIA
FT                   YVPQDPAMFHRTLRDNIAFARPDATDSDIRRAAEAAHVTEFADALPDGFDTMVGERGVK
FT                   LSGGQRQRVALARAILRDAPILLLDEATSALDSESEVLVQEALWRLMEGRTALVVAHRL
FT                   STVAAMDQVVVLDRGRIAEQGTHQELLASDGTYAKLWQHQVGGFLDDSPAPADLR"
     gtgacggtgc ccgcgatgct cctgcccgcg ttgggcaata tcggcatcaa ctacatcgcg        60
     ccgctgatcg tcgcgaagct cgtagcccga atcgccgacg acagcggtgt ctcgatcggc       120
     tcgacactgc cctacgttct cggcttcgtc ggcgtcctgc tgctggcgga gttgctgtgg       180
     cgtatcggca tacattgtct gaaccgcgtt gacgcgcacg gtatcgaaca cctgtatgtg       240
     atcggcatgg acgagttgtt cgccaaggac gcggcgttct tccacgacaa cttcgccggg       300
     tcgctgacca agcgggtcct gagcttcgcc tcccgcttcg aggagttcat cgacaccctg       360
     acgttctcgg tcgtgggcag cctcgtaccg ctggtgttcg cgtcggtggt gctctggagt       420
     tacgacccgc tgctcgttgt cgggctcttg gcgatgatcg cgctgacggc gctgtgtgcg       480
     gcgcccctca tccgccgccg ccagaagctc gttgatcagc gcgaggaggc gatcgcccgg       540
     gtggcggggc acgtcgccga cagcctgatg aacatggaca cggtccgggc gttcgccgcc       600
     gaggaacggg aggccgcgga gcatcggtcc cgcgtcgcgg agtcgcggcg gctctcgctg       660
     aggtcgtggg actacggcaa tctgcgcatc gacacgctgg tcgcgccgat gtccgtgctg       720
     accaacacgc tgggcctgct gctcgcggtc gcgctcggcg ggggcagcca cggtgtggag       780
     gcggtcgtgg tcgccttcac gtactactcc aacgcgacgc ggatcatgtt cgagttcaac       840
     cagatctacc gccgtctgga gagctcgatg acggaggccg cgcagttcac cgaactgctg       900
     ctgacgtcgc cgaccgtgct cgacccggag tcgccggagc cgctgcggtc cgagggcgcc       960
     ggtgtccgct tcgagaaggt ggccttcgcc cacgcgggcg cggagacact tttcgacggc      1020
     ctcgacctgg ctgtgcccag cgggacgagg gtcggtctcg tcggccggtc cggcgggggc      1080
     aagaccacgc tcacccaact gctgctgcgg acgacggaca tcgaagccgg ccggatcctg      1140
     atcggggggc aggacatcag caggctgcgc caggccgacc tgcgcagcct gatcgcctat      1200
     gtgccacagg acccggcgat gttccaccgc acactgcggg acaacatcgc gttcgcccga      1260
     ccggacgcca ccgactccga catccggcgc gcggccgagg cggcgcatgt cacggagttc      1320
     gccgatgcgc tgccggacgg cttcgacacc atggtcggcg agcgcggtgt caagctgtcc      1380
     ggcggacagc gccagcgggt cgctctggcc agggcgatcc tgcgcgacgc gccgatcctg      1440
     ctgctcgacg aggcgaccag cgccctggac tccgagagcg aggtcctcgt ccaggaggcg      1500
     ctgtggcggc tcatggaggg gcggacggcg cttgtggtgg cccaccggct gagcacggtc      1560
     gccgccatgg accaggtcgt cgtcctcgac cgcggacgga tcgccgagca gggcacacac      1620
     caggaactgc tcgcgtcgga cggcacctac gcgaagctgt ggcagcacca ggtgggcggt      1680
     ttcctcgatg acagccccgc accggccgac ctgcgctga                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page