(data stored in ACNUC7421 zone)

EMBL: CP002047.PE483

CP002047.PE483       Location/Qualifiers
FT   CDS_pept        562206..563786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00483"
FT                   /product="DNA-binding protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03604"
FT                   /db_xref="GOA:D7C0B3"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B3"
FT                   /protein_id="ADI03604.1"
FT                   /translation="MEARAHAGWLDELLHEVRRQMARRTGADPRAVLDWLSRQIDADIA
FT                   LVGSAGAVETATARFPRQILPSLEPTLARLAGGQMAAAATEAGALQVRLEALGPRAPRP
FT                   VLVVAGTSAPTPDAASLVSHAGSVIALLDRAQDADTTFRGYQHKARQLRFAVFSALLAG
FT                   DITLARRMTTGAVPALLDAQRLRVYLLQCTPEDRDRLAQIHQDGSGYHGTGLMVHCPAF
FT                   KEHLICLVAEDADGADGADGADETEVADGADADPETAHGQGTVLRRLVRENPHYALGIS
FT                   SPYPLGATAEAYGQALHALAAARHTPERVGAYLGRTPLVPLLPHEDAGTWARAFLRPLG
FT                   STPRATLDITRLAVTFPRSAVARLLDISRNTVSHHLRRVETTLGLDLSDVRTRAALDLA
FT                   FCLSPGPQSDDSLGGSGGSGGSGGAYGRPTPTLDELLRTEPAHAWAREFLRPLQDTRGR
FT                   DLHTTLCAWIDANTDAQRTARHLGLSRNTVRAHLRAAEHLLSRDLLTTGSGIHDLVHAL
FT                   HITGLPSAG"
     gtggaggcac gggcgcacgc cgggtggctg gacgagttgc tgcacgaggt gcggcggcag        60
     atggcccgga ggaccggggc ggatccacgg gcggttctcg actggctgag tcggcagatc       120
     gacgccgata tcgcgctggt cgggagtgcg ggcgcggtgg aaacggccac cgcgcgcttc       180
     ccacggcaga tcctgccctc gctcgaaccc acgctcgcgc ggctcgccgg tgggcagatg       240
     gccgcggccg ccaccgaggc cggagctctt caggtgcgtt tggaggcact cggcccccgc       300
     gcaccacgcc cggtcctggt ggtggccggc acctcggcgc ccacccccga cgcggcgtca       360
     ctggtctcgc acgcagggag cgtcatcgcg ctcctggacc gggcacagga cgccgacacc       420
     accttccgcg gctatcagca caaggcgcga cagctgcggt tcgccgtgtt cagcgccctg       480
     ctggcggggg acatcacact ggcccgacgg atgaccaccg gcgccgtccc ggcgctgctg       540
     gacgcccaac ggctgcgcgt ctatctgctg caatgcaccc ccgaggaccg tgaccggctg       600
     gcgcagatcc accaggacgg atcgggctat cacggcacgg ggctgatggt gcactgcccg       660
     gccttcaagg aacacctcat ctgcctcgtc gccgaagatg ccgacggggc cgacggggcc       720
     gacggggccg acgagaccga ggtggccgac ggggccgacg ccgaccccga gacggcccac       780
     ggtcagggca cggtgctgcg ccgcctggtc cgggagaatc cgcactacgc gctgggcatc       840
     agcagcccgt acccgctggg cgccaccgcc gaggcgtacg ggcaggccct gcacgccctt       900
     gccgcggcgc gtcatacacc cgaacgggtg ggcgcctacc tcggccggac accgctggtg       960
     ccactgctgc cccacgaaga cgcgggcacc tgggcccgcg ccttcctccg tccgctgggg      1020
     tccacgccga gggccaccct cgacatcacc cggctcgccg tcaccttccc cagatccgcc      1080
     gtggcccggc tgctggacat cagccgcaac accgtctccc accacctcag gcgggtggag      1140
     acaactctcg gcctcgacct gagcgacgtc cgcacccgtg ccgccctcga cctggccttc      1200
     tgcctgtccc ccgggccgca gtcggacgac agcttgggcg gctccggcgg ctccggcggc      1260
     tccggcggtg cgtacgggcg gccgacgccc accctggacg aactgctgcg caccgagccc      1320
     gctcacgcat gggcacggga attcctccgc ccgctccagg acacccgtgg ccgcgatctg      1380
     cacaccaccc tgtgcgcctg gatcgacgcg aacacggacg cccagcggac cgcccgccac      1440
     ttgggcctca gccggaacac cgtcagggcc catctgcgcg ccgccgaaca cctgctcagc      1500
     cgcgacctgc tcacgaccgg ttccggaatc cacgacctgg tgcacgccct gcacatcacc      1560
     ggtctgccct cggcgggctg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page