(data stored in ACNUC7421 zone)

EMBL: CP002047.PE484

CP002047.PE484       Location/Qualifiers
FT   CDS_pept        564355..568719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03605"
FT                   /db_xref="GOA:D7C0B4"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B4"
FT                   /protein_id="ADI03605.1"
FT                   /translation="MNTPEAEPAPAAAASGAAPDVQARPGPSADPKFATLKKDVQRKKR
FT                   SVASSHPPPKAEAGAAQDAARPPKDDEEAQGKTANAEKMNEAQPKDFDKDAFIKAVEKA
FT                   IAEKAPKNLDEADKFADSGKADEVRAEVHGKVGEGKADSAEQISTTTAAPPDTSAAVPK
FT                   KVVPMTPDRPPGTPGTPNPGNAVPDKLPPSATDLSAGPAQVDRQMTDAQVTETQLKKSN
FT                   EPTFKNALGEKKAAEQHSAVAPGRMRGHEKKELRAATAQAQRLGAAAMGAIGAQRVRTG
FT                   QQVGAGKTGAKGRDEEKRAQVTAVLQGVFDTMKKEVEAILDGLDKLVDDQFGREEKAAR
FT                   DAFTAEHKRKMEEYKDRRYSGWTGKARWVKDLFAGLPAEADKIFEAARDNYVRRMRQVI
FT                   SDVADTIGSELNRAKRRIAQGRTELQAAVRKLPADLRSIGQQAAAEFSDKFDELTQSVD
FT                   DKGTQLVDTLATKYTDALKSVDDEIAAEKEKNKGLVAKAVDAVKSVINTILELKRLLLS
FT                   VLAKAASAVMLILKDPIGFLRNLVSAVGAGLKQFLANIGRHLQQGIMSWLLGKTAEAGI
FT                   ELPSKFDAQGVLRMLASLLGLTWQNIRARIVRKVPKMEPAVAAAETAVPLVAEVRKRGV
FT                   AGMWDDLKTRVGDLKKDLLDKVIAYVTPTIVVAGIMWVISLLNPASAFVRAVKLIIDIV
FT                   RFIVTQARQIIEFVGAVLDAVIAIARGGSGGVPGMIERALARSIPVLLGVLAAILGVGG
FT                   IAARVKQIVQAMSKPVDRAVDWVIDKIVGLVKKLWSKIKSAFDRKKPKPKPKPKRRPDR
FT                   KRPGRPRRRRRPDQRRRPDRRRPKRKRDPKKKRPDKRSKKDMLRALDAAVRDATRLLNA
FT                   KSATEETIRRGLPAIKARHRLSSIELEKSARNTYFITVSINPKKKTPFKTLFPYKIGKA
FT                   AASTGLTDAGVSVGALHDIGNPMREKYAAAFVINMVATPNEVKAKPRIAARYLEEAWTG
FT                   SPEKKVAWARTAVIIGVNSAERLDPKRSKSGVPAISQALGAILRPDKLRMIAFGFVWTP
FT                   EWFDINSKKTVPFSTVKNTYDGLDDTHKKAARDEEGKGIGSKRAKAVPYGLLRGHVFTS
FT                   THTKRAVTVLSKVNQQVQVLSQDPDGGVRAPKGRGVLAAYDQILRTITGDPVMIVGGYD
FT                   FDELKWEEGAQERVVQLTQLANAIDRAVRAAVARHIPEMTYPTEPNTLVKVWDKNRRNG
FT                   VFQMMQNRADEAAKDALPFGFGEGEGRSFRKWLLRLYGNAFSIVHDQSASVSSDAKLND
FT                   PGRKLAVRGPGARSKRHVAYAIMLQSQSMANAQVLANELFLANQGLGLPAKNFVQMTVF
FT                   SHVEAVVKMMVDNPDLKVGDPKIQKAIDAMEKSVREYLGEKIPPKADRKSGDQRLHDIL
FT                   VRAEAMTREIITALTAEELKSVWRKLSLLLKEAQAEAKKNAEAAKHKKAGKR"
     gtgaacacgc cggaggcgga gcctgcgccg gctgccgcgg cctccggcgc cgcgccggat        60
     gtgcaggcgc ggcccggccc gagcgccgat ccgaagttcg cgacgctgaa gaaggacgta       120
     cagcgcaaga agcggtcggt ggcgagctcc catccgcccc cgaaggcgga agccggggcc       180
     gcgcaggacg ccgcccggcc gcccaaggac gacgaagagg cacagggcaa gaccgccaac       240
     gccgagaaga tgaacgaggc ccagccgaag gacttcgaca aggacgcgtt catcaaggcg       300
     gtcgagaagg cgatcgccga gaaggcaccg aagaacctcg acgaggcgga caagttcgcc       360
     gactccggca aggccgacga ggtgcgggcg gaggtgcacg gcaaggtcgg cgagggcaag       420
     gcggactcgg ccgagcagat ctccacgacg accgccgctc ccccggacac ctcggcggcc       480
     gtgcccaaga aggtcgtgcc gatgaccccg gaccggcccc cggggacccc tggcacgccg       540
     aatccgggga acgcggtgcc ggacaaactg ccgccgtcgg ccaccgactt gtccgccggc       600
     cccgcacagg tcgaccggca gatgacggac gcgcaggtca ccgagacgca gttgaagaag       660
     tccaacgagc cgacgttcaa gaacgccctg ggcgagaaga aggccgccga acagcactcc       720
     gcggtggctc ccggccggat gcgcgggcac gagaagaagg agctgcgcgc cgccaccgcg       780
     caggcccagc ggctcggcgc cgccgccatg ggcgcgatag gcgcccagcg ggtgcggacc       840
     gggcagcagg tcggtgcggg caagacgggt gccaagggcc gggacgagga gaagcgggcg       900
     caggtcacgg cggtcctgca aggggtcttc gacaccatga agaaggaagt cgaggcgatc       960
     ctcgacggcc tcgacaagct ggtcgacgac cagttcggca gagaagagaa ggcggcgcgg      1020
     gacgcgttca ccgccgagca caagcggaag atggaggagt acaaggaccg gcggtactcg      1080
     ggctggacag gcaaggcgcg ctgggtcaag gacttgttcg ccgggctccc cgccgaggcc      1140
     gacaagatct tcgaggcggc gcgcgacaac tacgtccgcc gaatgcggca ggtcatctcc      1200
     gacgtcgccg acaccatcgg cagcgagctg aaccgggcga agcgccgcat cgcccagggc      1260
     cggaccgaac tgcaggccgc cgtgcgcaag ctcccggccg acctgcggtc catcgggcag      1320
     caggcggcgg ccgagttcag cgacaagttc gacgagctca cgcagtccgt ggacgacaag      1380
     ggcacgcaac tcgtcgacac gctcgccacc aagtacaccg atgcgctcaa gtccgtcgac      1440
     gacgagatcg ccgcggagaa ggagaagaac aagggcctcg tggccaaggc cgtggacgcg      1500
     gtcaagtccg tcatcaacac catcctggag ctgaagcggc tgctgctgtc ggtcctggcc      1560
     aaggccgcgt cggcggtcat gctgatcctc aaggatccga tcggcttcct gcgcaacctg      1620
     gtctcggccg tcggcgccgg tctcaagcag ttcctggcga acatcggacg ccacctgcaa      1680
     cagggcatca tgtcctggct gctcggcaag accgccgagg cgggcatcga gctgccgtcc      1740
     aagttcgacg cccagggcgt gctgcggatg ctcgccagtc tgctcgggct gacctggcag      1800
     aacatccgcg cccggatcgt ccgcaaggtc ccgaagatgg aaccggcggt cgcggcggcc      1860
     gagaccgcgg tgccgctggt cgcggaggtc cgtaagcggg gcgtcgcggg gatgtgggac      1920
     gacctcaaga cgcgcgtggg cgacctgaag aaggacctgc tggacaaggt catcgcctac      1980
     gtcacgccga ccatcgtcgt cgccgggatc atgtgggtga tctcgctgct caaccccgcg      2040
     tcggcgtttg tccgggcggt gaagctgatc atcgacatcg tgcgcttcat cgtcacccag      2100
     gcacgccaga tcatcgagtt cgtgggcgcg gtgctcgacg cggtcatcgc gatcgcgagg      2160
     ggcggcagcg gcggcgtgcc gggcatgatc gagcgcgcgc tggcccgctc catcccggtg      2220
     ctgctgggcg tccttgccgc gatcctgggg gtgggcggga tcgcggcccg cgtcaagcag      2280
     atcgtccagg cgatgtccaa gccggtggac cgggcggtgg actgggtgat cgacaagatc      2340
     gtgggcctgg tgaagaagct atggtccaag atcaagtccg ccttcgacag aaagaagccc      2400
     aagccaaaac cgaagcccaa gcgccggccg gaccggaagc ggccgggcag gccacgtcgt      2460
     cggaggcgtc cggaccagcg gcgacgtccg gaccggcgga ggccgaagcg gaagcgcgac      2520
     ccgaagaaga agcgtcccga caagcgatcc aagaaggaca tgcttcgggc cctcgacgcc      2580
     gccgtgcgtg acgcgacgcg tctgctgaac gccaagtcgg cgacggagga gaccatacgg      2640
     cgagggcttc cggccatcaa agcgcgccat cgcctctcca gcatcgaact cgaaaagtcg      2700
     gcccgaaaca cctatttcat tacggtctcc atcaacccca agaaaaagac cccgttcaag      2760
     acgctcttcc cttacaagat cggcaaggct gcggcgtcga ccgggctcac cgatgccggc      2820
     gtgtcggtcg gcgccctgca tgacatcggc aatcccatgc gggagaagta cgcggccgcc      2880
     ttcgtcatca acatggtggc gacgcccaac gaggtgaagg cgaagccgag gatcgccgca      2940
     cgctatctcg aagaggcgtg gaccggctcc cccgaaaaga aggtggcctg ggccaggacc      3000
     gccgtcatca tcggcgtcaa ctccgccgaa cgcctggacc cgaagcgttc gaagagtggc      3060
     gtccccgcga tctcgcaagc actgggggcg atcctgcgcc cggacaagct gcgcatgatc      3120
     gcgttcggct tcgtctggac tccggaatgg ttcgatatca acagcaagaa gaccgttccg      3180
     ttcagcacgg tgaaaaacac gtacgacggc ttggacgaca cgcacaagaa ggccgcacgt      3240
     gacgaggagg ggaagggcat cggcagcaag cgggcgaagg cggtgccgta cgggctcctg      3300
     cgcgggcacg tcttcacgtc cacgcacacc aagcgcgcgg tcaccgtcct cagcaaggtc      3360
     aaccagcagg tgcaggtcct gagccaggac cccgacggcg gcgtccgcgc ccccaagggc      3420
     cgcggcgtgc tggccgcgta tgaccagatc ctccgcacca tcaccggcga tccggtcatg      3480
     atcgtcggcg gctacgactt cgatgagctc aagtgggaag agggcgccca ggagagggtg      3540
     gtccagctga cgcagctcgc caacgcgatc gaccgggcgg tccgggcggc cgtcgcccgg      3600
     cacatcccgg agatgacgta ccccaccgag cccaacaccc tggtcaaggt ctgggacaag      3660
     aatcgccgga acggcgtttt ccagatgatg cagaatcggg ccgacgaggc ggccaaggac      3720
     gcgcttccct ttggtttcgg cgaaggggaa gggcgcagtt tccgcaagtg gctgttgcgt      3780
     ctctacggca acgccttctc catcgtccat gaccagagcg catccgtcag cagcgacgcg      3840
     aagctgaacg accccggtcg caaactcgcg gtgcgcgggc caggcgcgcg cagcaaacgc      3900
     cacgtggcgt acgcgatcat gctgcagtcg cagtcgatgg cgaacgcgca agtactggcc      3960
     aacgagctct tcctggcgaa tcaaggattg ggcctcccgg ccaagaactt cgtgcagatg      4020
     acagtcttct ctcatgtgga ggccgtcgtc aaaatgatgg tcgacaaccc ggacctgaag      4080
     gtgggcgacc cgaaaatcca gaaagccatc gacgccatgg aaaaatcggt ccgggaatac      4140
     ctcggagaga agatcccgcc gaaggcagac cgcaagtccg gggatcaaag gctgcacgac      4200
     atcctggtca gggcggaagc catgacgcgc gagatcatca ccgcattgac ggcagaggaa      4260
     ctcaagagcg tctggcggaa gctgtccctc ctgctgaagg aggcacaggc cgaggccaag      4320
     aaaaacgcgg aagcggcgaa gcacaagaaa gcggggaaaa ggtaa                      4365
//

If you have problems or comments...

PBIL Back to PBIL home page