(data stored in ACNUC7421 zone)

EMBL: CP002047.PE485

CP002047.PE485       Location/Qualifiers
FT   CDS_pept        568720..569361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03606"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B5"
FT                   /protein_id="ADI03606.1"
FT                   /translation="MDESALRQLRAEASRADYASMARLAHALYENGLSVPEVMRECYGV
FT                   DLPTEFLVLAEADLWRLDLLLVCTHQPWWLAVPPTRGGPVAAPDPPTGTERKLLALDPD
FT                   LLPLGYTLGTNSPPWENKEVLCYRLSELAAGRPTVFRLREKSTRRDKVKRRGESLMTVL
FT                   EELHLEELRETERQMRDWDVGAEEELVGAARELVERVEELRRKVAAREAR"
     gtggacgagt ccgcgctccg gcagctgcgg gcggaggcgt ctcgcgcgga ctacgcctcg        60
     atggcccgtc tggcgcacgc cctgtacgag aacggcctgt ccgtgccgga ggtcatgcgc       120
     gagtgctacg gggtcgacct gccgacggag ttcctggtac tcgccgaggc cgacctatgg       180
     cgtctcgacc tactgctcgt gtgtacccat cagccgtggt ggctggccgt cccgccgacc       240
     cggggcggcc ctgtggccgc cccggatcca cccaccggga cggagcgaaa gctcctcgcg       300
     ctcgaccccg atctcctgcc cctcggctac acgctcggca cgaacagccc accctgggag       360
     aacaaggagg tgctctgcta ccggctctcc gagctcgccg caggtcggcc gaccgtcttc       420
     aggctgcggg agaagtccac tcgtcgcgac aaggtgaagc ggcgaggcga atccctgatg       480
     acggtgctgg aggaactcca cttggaggaa ctgcgcgaga cggagcgtca gatgcgcgac       540
     tgggacgtcg gcgccgagga ggagcttgtg ggggctgcac gggaattggt cgagcgggtc       600
     gaggagctgc ggcgcaaggt ggcggcacgc gaggcgcggt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page