(data stored in ACNUC7421 zone)

EMBL: CP002047.PE486

CP002047.PE486       Location/Qualifiers
FT   CDS_pept        complement(569438..569740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03607"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B6"
FT                   /protein_id="ADI03607.1"
FT                   /translation="MTQMLPTEPPLSLHRLVAPVPPARTQETAMATRQVPAPAPVPVSN
FT                   ATMAHSMHALAKMSPPAAQDQLGNAATTKAAAQAAPAVRLFFVPVKSPWEDAPTR"
     gtgacccaga tgctgcccac cgaacccccg ctctccctcc accggctggt ggctcccgtc        60
     ccaccggcgc gcacccagga aacggcgatg gccacccgtc aggtgccggc tccggcgccg       120
     gtgccggtga gcaacgcgac gatggcccac agcatgcacg cgctggccaa gatgtcaccg       180
     cccgctgccc aggaccagct cggcaacgca gccacaacca aagcggccgc gcaggcggcc       240
     ccggctgtac ggctgttctt cgtgccggtg aagtcgcctt gggaggacgc cccgactcgg       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page