(data stored in ACNUC7421 zone)

EMBL: CP002047.PE488

CP002047.PE488       Location/Qualifiers
FT   CDS_pept        complement(571857..573719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03609"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B8"
FT                   /protein_id="ADI03609.1"
FT                   /translation="MSAPTAPTVPSAGPSAGETGDITVHRCTVTVVRRGGWSWGPDPRG
FT                   LVRQVVDALPELLADHFAERLAGDGPDVEITEPLTVTVRPGRPGGPGRPAGGGPAVEVH
FT                   FAPVPVVELPADASGADAMSLEESFAAAPDPWTVPSAAVLFAELAERGELDALLALLPD
FT                   ESVRAYLRAVLGVDDTAAPAARLLAELVGRALAAAPPPADPHGLAAARSRPVEALPQRL
FT                   RAAVAGAEAADLPRLLADYLASADREETVRLARSLGPGGPYDHTADQPPGETRTTDEVR
FT                   TANPVRTTGEVRVWSALPFLLAGPLARIGYLDAIGPALAGVELADQAPLFAAALGYKVL
FT                   GVTARGWRRADRDSEAAAAFAGLQPPVAEERLAAFARQVRPALPVLDGVLALSVCRGHD
FT                   PAHPLLITGTDHGLFLVDAHGMFPIAWAAQAAGLLPYWQACGHPPVLLCDGPLPPGTLR
FT                   ELAAAGVLFLTGVRPLRGDPVARLPWRTPLWTAEGTAPDVRLAAELPAHAQRFADLAAA
FT                   LVGERRAVPLAPDGGLERTVTLAATLGLATIAWTLWRDRETPDPLSALSRFADLEATVR
FT                   YEPAAVRVRVPMGRRHADLLRGGLLADVPDVVWLNGRTLTFSAG"
     atgagcgcgc ccaccgcgcc caccgtgccg tccgccggcc cgtccgccgg cgagaccggc        60
     gacatcacgg tgcaccggtg caccgtgacg gtggtccggc gcggtgggtg gagctggggg       120
     cccgatccac gcggcctggt ccgccaggtg gtcgatgccc tgcccgagtt gctggccgac       180
     cacttcgccg agcggctggc gggagacggg ccggacgtgg agatcaccga gccgcttacc       240
     gtcaccgtcc ggccgggccg gcccggaggg cccggccgac ccgcgggcgg cgggccggcc       300
     gtcgaggtgc acttcgcgcc ggtgccggtg gtggaactgc ccgccgacgc gtccggcgcc       360
     gacgccatgt ccctcgagga gtccttcgcg gcggcgccgg acccgtggac cgtcccgagc       420
     gccgccgtgc tcttcgccga actcgcggag cgcggggaac tggacgcgct gctggcactg       480
     ttgccggacg agtcggtgcg ggcgtatctg cgcgccgtgc tcggcgtcga cgacacggcg       540
     gccccggccg cacggctgct cgccgaactc gtcgggcgcg ccctcgcggc ggcccctccg       600
     cccgccgacc cgcacggcct ggccgccgcc cggtcccggc ccgtcgaggc actgccccag       660
     cggctgcgcg ccgcggtcgc gggcgccgaa gcggcggacc tgccccggct gctcgccgac       720
     tacctggcgt cggcggaccg cgaggagacg gtacggctgg cgcggtccct gggccctggc       780
     ggcccgtacg accacaccgc ggatcagccg ccgggggaga cgcgtaccac cgacgaggtg       840
     cgtacggcca acccggtgcg caccaccggc gaggtacggg tgtggtcggc gctgcccttc       900
     ctgctcgccg ggccactggc acgcatcgga tacctcgacg ccatcggccc cgcactggcc       960
     ggagtcgaac tggccgacca ggcaccgctg ttcgcggcgg ccctgggcta caaagtgctg      1020
     ggcgtgaccg cacgtggctg gcgccgcgcc gaccgggaca gcgaggccgc ggccgccttc      1080
     gccggcctcc agccacccgt cgccgaggag cggctggccg ccttcgcccg ccaggtgcgc      1140
     cccgcgctcc cggtcctcga cggcgtactg gcgctgtcgg tgtgccgcgg ccacgacccc      1200
     gcccatccgc tcctgatcac ggggacggac catgggctgt tccttgtcga cgcccacggc      1260
     atgttcccga tcgcctgggc cgcgcaagcc gccgggctgc tgccgtactg gcaggcgtgc      1320
     gggcacccgc ccgtactgct ctgcgacggc cccctgcccc ccggcaccct gcgcgaactg      1380
     gccgcggccg gcgtgctgtt cctgaccggc gtacggccgc tgcgcggcga tccggtggcg      1440
     cggctgccct ggcgcacacc gctgtggacc gccgagggca cggccccgga cgtacgcctc      1500
     gccgcggaac tccccgccca cgcacagcgg ttcgcggacc tggccgccgc gctggtcggc      1560
     gagcgccggg cggtaccact ggcgcccgac ggcggcctgg agcgtacggt caccctggcc      1620
     gcaaccctcg gtctggccac catcgcctgg acgctctggc gcgaccgcga gaccccggat      1680
     ccgctgtcgg ccctgagccg cttcgccgac ctggaggcca cggtgcgata cgagcccgcg      1740
     gccgtccggg tacgcgtccc gatgggccgg cgccacgcgg acctgctgcg cggcggtctg      1800
     ctcgccgatg tgcccgacgt ggtctggctg aacggccgga ccctgacctt ctcggccggg      1860
     tga                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page