(data stored in ACNUC7421 zone)

EMBL: CP002047.PE489

CP002047.PE489       Location/Qualifiers
FT   CDS_pept        complement(573716..574246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03610"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B9"
FT                   /protein_id="ADI03610.1"
FT                   /translation="MALSVVYAVDTGHVVGALALTGAGAPPDVAALVGRALPLRVSLGT
FT                   GRIATLPLSARDLAVASVDDEPAALAVPLDFGVEVTSDGKPKPALVRLASWTDGIALTE
FT                   DGLTVTVKVAVARPTPVLALVSDEQDTHVLAGEIPAQQTQAKLPVTLVKGSVHGVLVLA
FT                   TGWAGHLEKAAVT"
     atggctcttt ccgtggtgta cgcggtcgac accggccatg tcgtgggcgc gctggccctg        60
     accggggccg gtgccccgcc cgatgtggcc gcactggtgg gacgcgcgct gccgctgcgc       120
     gtctccctgg gcacaggccg tatcgcgacc cttccgctga gcgccaggga cctcgccgtg       180
     gcgtccgtgg acgatgaacc ggcagccctc gccgtgccgt tggacttcgg ggtcgaggtg       240
     acgtccgacg gcaaacccaa accggcgctg gtgcgcctcg cgtcgtggac cgacggcatc       300
     gcgctgaccg aggacgggct caccgtcacc gtgaaggtcg ccgtggcccg ccccaccccc       360
     gtcctcgccc tggtctccga cgagcaggac acccatgtgc tcgccgggga gatccccgcc       420
     cagcagaccc aggcgaaact gccggtgacc ctcgtcaagg gcagtgtgca cggggtgctg       480
     gtgctcgcga ccggctgggc gggccacctg gagaaggcgg cggtgacatg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page