(data stored in ACNUC7421 zone)

EMBL: CP002047.PE49

CP002047.PE49        Location/Qualifiers
FT   CDS_pept        44207..45625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00049"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03170"
FT                   /db_xref="GOA:D7BUH9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUH9"
FT                   /protein_id="ADI03170.1"
FT                   /translation="MGSLGADDPAEVGAYRLLGVLGHGGMGRVYLGRSQGGRLVAVKVV
FT                   HRHLAADERFRARFASEVAAARLVSGEQNHNRTAPVLTADPEAEVPWVATGYVAGSDLA
FT                   HMVEEHGPLPERTVRALGIGLAEALGAVHAQGLVHRDVKPSNVLLALDGPHLIDFGIAR
FT                   AAEAATRLTSTGVAVGSPGFMAPEQVTGEAAVGPATDVFSLGTVLAYAASGQQPFPGES
FT                   AAQLLYRVAHAEPRLDGVAPDAVKELVSACLAKDPAARPTLPEVVRALAGEQDAGASLD
FT                   SSRWLPTAVADDIGRRAVELLQLESGPADPGLPARPHSPTLVDSAPASGPNAATVTVTA
FT                   QPKPETTAKPELANKPEPPDAQAKKQGPWLAVGASALLAVLIFGVWNAFQDDDKTAALP
FT                   NSFVGHWSDSANGYGNQLELNAGRVGEEVGRLTADVDACRRSSRRVWALLPAARMRRPA
FT                   RWSRRRSPFWMPHR"
     ttggggtcgc tgggcgcgga cgacccggcc gaggtggggg cgtaccggtt gctgggggtg        60
     ctcgggcacg gcggtatggg gcgggtgtat ttggggcgga gccagggtgg gcggctcgtt       120
     gccgtgaagg tggtgcaccg gcatctggcg gcggatgagc ggttccgggc gcgattcgcg       180
     agcgaggtgg cggcggcgcg gctggtgagc ggggaacaga accacaaccg caccgccccc       240
     gtgctcaccg ccgatccgga ggccgaggtg ccgtgggtgg cgaccggcta cgtggcgggc       300
     agcgacctgg cgcacatggt ggaggagcat ggcccactgc ccgagcgcac cgtacgtgcg       360
     ctgggtatcg ggctggccga ggcgctgggc gccgtacatg cacaagggct ggtgcatcgg       420
     gatgtcaagc cgtccaatgt gctgctcgcg ctcgacggcc cgcacttgat cgacttcggc       480
     atcgcccgcg ccgccgaggc ggccacccgg ctcacctcga ccggcgtggc tgtcggctcg       540
     cctggcttca tggctcccga gcaggtcacc ggcgaggcag ccgtcggccc tgccacggac       600
     gttttctcac tcggaaccgt gctcgcctac gcggccagcg gccagcagcc atttcctggt       660
     gagagtgccg cccaactcct ctaccgggtc gctcacgccg agccgcggct tgacggtgtt       720
     gcaccggatg ccgtgaagga gctggtctcc gcctgtctcg ccaaggatcc tgccgcccgt       780
     ccgacactgc cggaagtcgt gcgggccttg gccggcgagc aggatgcggg cgcatcactg       840
     gattcctccc gctggctgcc cacggctgtc gccgacgaca tcggtcgccg ggctgtcgaa       900
     ctgctccagc tggagtccgg accggcggac cccgggctgc ccgcgcggcc ccactcgccc       960
     accctcgtgg actccgcacc ggcctccggc ccgaacgccg cgacagtgac ggtgaccgcc      1020
     cagccgaagc cggagaccac ggccaagcct gagttggcga acaagccgga acccccggat      1080
     gcccaggcga agaagcaagg cccgtggctg gccgtgggag cctctgcgct gctcgctgta      1140
     ttgatcttcg gtgtctggaa cgccttccag gacgacgaca aaaccgctgc cctccccaac      1200
     agcttcgtcg gccattggag cgactcggcg aacggctacg gcaaccagct cgagctcaac      1260
     gcgggccgag tcggcgaaga ggtgggtagg ctcaccgccg atgtcgacgc ctgccgccgc      1320
     tcatcgaggc gcgtatgggc gctactgccg gcagcgcgga tgcgaaggcc cgcgcggtgg      1380
     tcacgacggc gttcgccttt ctggatgccg catcgatga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page