(data stored in ACNUC7421 zone)

EMBL: CP002047.PE490

CP002047.PE490       Location/Qualifiers
FT   CDS_pept        complement(574249..575385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03611"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C0"
FT                   /protein_id="ADI03611.1"
FT                   /translation="MTGPLRPAFHEGQVLAAADLTAAVEHARGQSARHARHLHEWGIVE
FT                   GLGLATEARTDPLTGVRHVEVSVAAGIALDGTGREVVVTEPAVLRESDFEEVNGADQPT
FT                   DEPYPVFLTAADREPAQRPGPVSCSGSATKTRVEESYQILFGRLGDERLVEEQQPPAIG
FT                   DPPADPPVRWLILLGYVRWTDGHFSGVETTARGVVVRFAGVRADTVVARSGALTLRTAP
FT                   AAQEGKPALVLSGGDQPSLVFGLYQGGGAVAPLMTVAANGNLAIAGSFSGRMPAGSTLV
FT                   ASGTATDGMLLPLPSGVTPEQVADGRVVIHVQLTPRTPPLADTALYSPVEATVDGDRRV
FT                   RCRMRLYDPLVTPAKVVEQPGAVDFLVLATVAATNGGG"
     atgacgggcc ccctgcgccc cgccttccac gagggtcagg tgctggccgc cgcggacctg        60
     acggccgccg tggagcacgc ccgcggccaa tccgcccggc acgcccgcca cctgcacgaa       120
     tggggcatcg tggaaggcct cggcctggcc accgaggccc gtaccgaccc gctgaccggg       180
     gtccgccatg tcgaggtgag cgtcgcggcg gggatcgccc tcgacgggac cggccgcgag       240
     gtggtcgtca ccgagccggc cgtgctgcgc gagagcgact tcgaggaggt caacggcgcg       300
     gaccagccga ccgacgaacc ctacccggtc ttcctcaccg ccgccgaccg ggaaccggcc       360
     cagcgccccg ggccggtctc ctgctccggg agcgccacga agacccgcgt ggaggagtcg       420
     taccagatcc tcttcgggcg cctgggcgac gagcggctgg tcgaggagca gcagccgccc       480
     gcgatcggcg atccgccggc cgatccgccc gtccgctggc tgatcctgct gggctacgtc       540
     cgctggaccg acggacactt cagcggcgtc gagaccacgg cgcgcggggt cgtggtgcgc       600
     ttcgcgggcg tgcgcgcgga caccgtcgtc gcccggtcgg gtgcgctgac cctgcggacg       660
     gccccggcgg cccaggaggg caagcccgcg ctcgtactgt ccggcggtga ccagccgagc       720
     cttgtcttcg gcctctacca gggcggtggc gcggtcgctc cgctgatgac cgtggccgcc       780
     aacggcaacc tggcgatcgc gggcagcttc agcggccgga tgccggccgg cagcacgctg       840
     gtggcctccg ggacggccac cgacgggatg ctgctgccgc tgccgtccgg cgtcaccccg       900
     gaacaggtcg ccgacggccg cgtggtgatc catgtccaac tgaccccgcg caccccgccc       960
     ctggcggaca cggccctgta cagcccggtg gaggccaccg tggacggcga ccggcgggtc      1020
     cgctgccgca tgcgcctgta cgaccccctg gtgaccccgg ccaaggtcgt cgagcagccc      1080
     ggggcggtcg acttcctcgt tctggcgacg gtcgcggcaa cgaacggcgg tggctga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page