(data stored in ACNUC7421 zone)

EMBL: CP002047.PE491

CP002047.PE491       Location/Qualifiers
FT   CDS_pept        complement(575382..577397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03612"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C1"
FT                   /protein_id="ADI03612.1"
FT                   /translation="MRTDCGCGCGGDATSTSAFVRPRFFAGQLLTEDDLSLLVEYTTAK
FT                   RRLHNRSLYGPGVICGLGVSCDPCGGGTVAVHPGHALDCAGNDIVVPCTERVDVRALVR
FT                   DRRISALGVDCGEDCDDDGGRRYGLYVRYQESPVEPVAPYATEEPCPSPGCEPSRIQEG
FT                   FRFVVGCDDVEDHRHNPGTRLLASIGDLARADRARIRDRRLGMYVDALLVASLGTGRTF
FT                   RFDAADARRYATAFAWLRANAGGEGPPPPPTAREMTEHVRALAAAIARFDTYDPAGREQ
FT                   LAKDYPDLATAREARGVLGTACERLKGADMEAVWPDPLRRTIAHAVVTETAARVVPEGG
FT                   DPDAPLEVRMLAQGTPLGHALRVEFRADIGLIREWLLGRLDQAADLADCALRTEVAAVD
FT                   VPPLLPPPPPDSTEKATVAEVQQIAEAAAALGTAVSRFLTDAACATLNPPCGDSADTDV
FT                   LLAHLELDGCDVVRVCSATREQVLPGGSAYGEWLPKLYRLRELAERVCCGPLPAYQKPT
FT                   LPSEGPVARPYAEGLLGDWPRTGDLEEMLSLLLTPAPGETPPKALHEQVYTTPSEVTDS
FT                   MQELARLRTQVSDLTAALEGLRTQMSSAQTQVTHLAEQLPERLGPRLADLEGAPDEGAD
FT                   QAPDEAAGRAEEPAKPPQPPAKRARAPRTRKSGETP"
     atgcgaacag actgcggatg cggctgcggt ggcgacgcca cctcgacctc cgccttcgta        60
     cgtcctcgct tcttcgcagg gcaactgctg accgaggacg acctcagcct gctggtcgag       120
     tacacgacgg cgaagcgcag actgcacaac cggtccctgt acgggccggg agtcatctgc       180
     ggcctcggcg tcagctgcga cccgtgcggc ggcggaactg tggcggtcca ccccggacac       240
     gcgctggact gcgccggaaa cgacatcgtg gtgccctgca ccgaacgggt cgacgtacgg       300
     gctctggtgc gggaccggcg catcagcgcg ctcggcgtgg actgcgggga ggattgcgac       360
     gacgatggtg ggcggcgcta cgggctgtat gtgcgctacc aggagtcccc cgtcgagccg       420
     gtggccccgt acgccacgga ggagccctgc ccctcgccgg gatgtgagcc ctccaggatc       480
     caggaggggt tccgtttcgt cgtcggctgc gacgacgtcg aggaccaccg ccacaacccc       540
     ggcacccggc tgctggcgag catcggcgac ctcgcgcggg ccgaccgggc ccgcatccgc       600
     gaccggcggc tcggcatgta cgtcgacgcc ctcctcgtcg cgtcgctcgg caccggccgc       660
     accttccgct tcgacgccgc cgacgcgcgg cggtacgcca ccgccttcgc ctggctgcgc       720
     gcgaacgcgg gcggggaggg cccgccgccc ccgccgacgg cccgcgagat gaccgagcac       780
     gtacgcgcac tggccgccgc catcgcccgg ttcgacacct acgacccggc cgggcgggaa       840
     cagctcgcga aggactaccc ggacctcgcc accgcgcggg aggcccgcgg cgtcctgggc       900
     accgcgtgcg aacggctcaa gggcgccgac atggaagcgg tgtggccgga cccgctgcgc       960
     cgcaccatcg cccacgccgt cgtcaccgag accgcggccc gcgtcgtacc ggagggcggc      1020
     gacccggacg cgccgctgga agtgcgcatg ctggcccagg gcacaccgct cggccacgcg      1080
     ctgcgggtgg agttccgcgc ggacatcggc ctgatccggg agtggctgct cggccggctc      1140
     gaccaggccg ccgacctcgc cgactgcgcg ctgcgcacgg aggtcgccgc cgtggacgta      1200
     ccgccgctgc tgccgccccc gccgccggac agcaccgaga aggcgaccgt cgccgaggtg      1260
     cagcagatcg cggaggcggc cgcggcactg ggcaccgcgg taagccggtt cctgaccgac      1320
     gccgcatgcg ccaccctgaa cccgccgtgc ggcgacagcg ccgacaccga cgtcctgctc      1380
     gcgcatctgg agctggacgg ctgcgatgtc gtacgggtct gctcggccac ccgggaacag      1440
     gtgctgccgg gcggctcggc gtacggcgag tggctgccca agctctaccg gctgcgggag      1500
     ctcgccgagc gcgtgtgctg cgggcccctc ccggcgtacc agaagccgac gctcccgtcg      1560
     gagggcccgg tggcgcgccc atacgccgag gggctgctcg gcgactggcc gcgcaccggg      1620
     gacctggagg agatgctgtc cctgctgctg acccccgcac ccggcgagac gccgcccaag      1680
     gcgctgcacg aacaggtcta tacgacgccc agcgaagtca ccgacagcat gcaggaactg      1740
     gcccggctcc ggacgcaagt ctccgacctc accgccgcct tggaggggct gcgcacccag      1800
     atgagcagcg cacagacgca ggtgacccat ctggcggagc agctgccgga acggctcggg      1860
     ccccgcctcg cggacctcga aggcgcaccg gacgagggag cggaccaggc gccggacgag      1920
     gcagcgggcc gggcggagga gcccgccaag cccccgcagc ccccggccaa gcgcgcccgg      1980
     gcgccccgta cccggaagtc cggtgagacg ccatga                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page