(data stored in ACNUC7421 zone)

EMBL: CP002047.PE494

CP002047.PE494       Location/Qualifiers
FT   CDS_pept        complement(582684..584297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03615"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR011749"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C4"
FT                   /protein_id="ADI03615.1"
FT                   /translation="MSSPSRTTWPSSRSPRTARSPCGPIATVRRTCGPPRRGVALLAGD
FT                   GAPAQVRFTLPLTGAHPAPGPICLLVELDAPAASAPSWLPGAVADVPPPAELTWSWFRP
FT                   GTDVSGAFEKVEDGTAGLRRSGVVRLHPPAGWTTRDTGLLVSTPAATYAAPPRLLQLAV
FT                   NVSAAHHLRRRTARGSDLQEQIDAWLKLPGQHLVLPDAADRLLEATVQLAGQQWQPVPD
FT                   FTFGAPADRIFVLDRTEGAVVFGDGLTGRIPRPGPDAQIEYATGGGRGGNGGMTGNWLA
FT                   APDLPAPPGAVSAANLVRAEGGTDPETVTEARRRAAASLGEVTRAVTAADYVTLARTTP
FT                   GVAVARAYPSLGEHPGFPCATVPGAVSVHIVPAAPRDDLDREDFVAAPLPDPGMVCAVA
FT                   ARLAQARLLTSEVIVRPPRYREVTLRVDLSGDPADRSRVSTVVTAALRRFLDPLVGGED
FT                   QDGWPFGQPLRPSALLRAAQRALGDLGDIAAVAIGLDGVDSDGAFEACDEVPLGAGALP
FT                   VLRTVRTRIVPAVEPGEGLV"
     ttgtcttcac cctcgcggac gacgtggccg tcttcccgct cgccgaggac ggcgaggtca        60
     ccgtgtggac cgatcgcgac cgtacggcgg acctgcgggc ccccccgccg cggtgtcgcg       120
     ctgctggcgg gcgacggtgc cccggcacag gtccggttca ccctgccgct caccggagcg       180
     caccccgcgc ccggcccgat ctgcctgctt gtcgaactgg acgcgcccgc cgcgtccgcg       240
     ccgtcatggc tgcccggggc ggtcgccgat gtgccgcctc ccgcggagct gacctggtcc       300
     tggttccggc cgggcacgga tgtctccggc gcgttcgaga aagtagagga cggcacggcc       360
     gggctcagac ggtccggtgt cgtccggctg caccccccgg ccggctggac cacacgggac       420
     accggactcc tggtgtcgac cccggccgcc acctacgcgg caccgccccg cctcctccaa       480
     ctcgccgtca acgtcagtgc cgcacaccac ctcaggcgcc gcaccgcgcg cggcagcgat       540
     ctccaggagc agatcgacgc gtggctcaaa ctgcccggcc agcatctggt cctcccggac       600
     gccgccgacc gcctgctgga ggcgaccgtg caactggcgg gtcagcagtg gcagccggtg       660
     ccggacttca ccttcggcgc accggccgac cggatcttcg tactcgaccg gaccgagggc       720
     gcggtggtct tcggcgacgg actcaccggg cgcatccccc gccccggccc ggacgcgcag       780
     atcgagtacg cgaccggcgg cggccgaggc ggcaacggcg gtatgaccgg caactggctg       840
     gcggccccgg accttccggc cccgccgggc gcggtctcgg ccgccaacct cgtacgggcc       900
     gaaggcggca cggacccgga gacggtcacc gaggcgcgcc ggcgcgctgc cgcgtccctg       960
     ggggaggtga cccgcgcggt caccgccgcc gactacgtca ccctggcccg tacgaccccg      1020
     ggcgtcgccg tcgcccgcgc gtacccgtcc ctcggcgaac accccggctt cccgtgtgcc      1080
     acggtgcccg gcgcggtgag cgtccatatc gtcccggcgg cgccccggga cgacctcgac      1140
     cgcgaggact tcgtcgccgc gccgctcccc gaccccggca tggtgtgcgc ggtcgccgcc      1200
     cgcctggcac aggcgcggct gctcacctcc gaggtcatcg tccgcccgcc ccgctatcgc      1260
     gaagtgacgc tgcgcgtcga cctgtccggc gacccggccg accgcagccg cgtgtccacc      1320
     gtggtcaccg cggcgctgcg ccgcttcctc gacccgctcg tgggcggtga ggaccaggac      1380
     ggctggccgt tcggacagcc gctgcggccc tccgccctgc tgcgggccgc gcagcgggcg      1440
     ctgggggacc tcggggacat cgccgcggtg gcgatcggcc tcgacggggt ggactcggac      1500
     ggggctttcg aggcgtgcga cgaggtgccg ctcggggccg gggcgcttcc cgtcctgcgg      1560
     acggtccgca cccggatcgt gcccgccgtc gaaccggggg aggggctggt atga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page