(data stored in ACNUC7421 zone)

EMBL: CP002047.PE495

CP002047.PE495       Location/Qualifiers
FT   CDS_pept        584522..584662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03616"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C5"
FT                   /protein_id="ADI03616.1"
FT                   /translation="MPGSTGACSVQVPSDSAGIRRRMAAIMSAQVRSSSFGAGSVMMCP
FT                   R"
     atgccggggt cgacgggcgc gtgcagcgtc caggtgccgt ccgattcggc ggggatccgc        60
     cgccggatgg ccgccatcat gtcggcccag gtgaggtcgt cgagcttcgg cgcgggcagt       120
     gtcatgatgt gcccccggtg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page