(data stored in ACNUC7421 zone)

EMBL: CP002047.PE496

CP002047.PE496       Location/Qualifiers
FT   CDS_pept        complement(584643..585065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00496"
FT                   /product="tail lysozyme, putative"
FT                   /note="COG3628 Phage baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03617"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C6"
FT                   /protein_id="ADI03617.1"
FT                   /translation="MSEEFLGTGWRFPILPDASGRLGYAVGEESIEHCLRALLLTGVGE
FT                   RVMRPDLGTRAHELVFAPGSVQNLRDLEQSIATAVRDHEPRVELEEVRAEADPADESRI
FT                   TVSVVYRIRRSNTKANLVFPFYTGLTGLTGLTGGTS"
     atgagcgagg agttcctggg gaccggctgg cggttcccga tcctgcccga cgcgtccggg        60
     cggctcgggt acgccgtcgg cgaggagagc atcgagcact gtctgcgggc gctgctgctc       120
     accggcgtcg gcgagcgggt catgcggccc gacctgggca ctcgcgccca cgagctggtg       180
     ttcgcgcccg gcagcgtgca gaacctgcgc gacctggagc agtcgatcgc caccgcggtc       240
     cgtgaccacg agccgcgagt ggaactggaa gaggtacgcg cggaggccga cccggccgac       300
     gagtcgcgga tcaccgtctc ggtcgtctac cgcatccggc gcagcaacac caaggccaac       360
     ctggtgttcc cgttctacac cggcctcaca ggccttacgg gcctcaccgg gggcacatca       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page