(data stored in ACNUC7421 zone)

EMBL: CP002047.PE497

CP002047.PE497       Location/Qualifiers
FT   CDS_pept        complement(585062..585763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00497"
FT                   /product="hypothetical protein"
FT                   /note="COG3501 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03618"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C7"
FT                   /protein_id="ADI03618.1"
FT                   /translation="MTMRGTPRARSTDKRYYGVVEALVVENEGDDEGQVKLKFPWFDDT
FT                   TVTDWVRVSQLYAGGGYGSVFVPEKGDEVLVAFVHGDMRYPIVLGGLYNGEDKPPTART
FT                   EGRDQKLIRTRHGHEVLLDDTQSKAAVKITSAAGHVVELDDQGKAIRITAAEGGSVTVT
FT                   AQGEITLKAPKVTLDSPSIDLGGGATEPLVLGNALLQAFNAHTHPSAAGPTGPPTPPLT
FT                   PAVLAKKARTA"
     gtgaccatga ggggcacacc acgcgcccgc tccacggaca agcgctacta cggcgtcgtc        60
     gaagcgctcg tcgtggagaa cgagggcgat gacgaaggcc aggtcaagct gaagttcccg       120
     tggttcgacg acaccacggt cacggactgg gtccgggtca gccagctgta cgccgggggc       180
     ggctacggct cggtgttcgt gcccgagaag ggcgacgagg tgctggtcgc gttcgtccac       240
     ggggacatgc ggtacccgat cgtcctgggc ggcctctaca acggcgagga caaaccgccg       300
     accgcccgca ccgaaggccg cgatcagaag ctcatccgga cccggcacgg ccacgaagtg       360
     ctgctggacg acacccagtc caaggccgcc gtgaagatca cctccgccgc cggacatgtg       420
     gtggagctcg acgaccaggg caaggcgatc cggatcaccg cggccgaggg cggcagcgtc       480
     accgtgaccg cgcagggcga gatcaccctc aaggccccga aggtgacact cgattccccc       540
     tccatcgacc tcggcggcgg cgccaccgaa ccgctcgtac tcggcaacgc gctgctccag       600
     gcgttcaatg cgcacaccca cccctccgcc gccgggccga ccggcccgcc gaccccgccg       660
     ctgacccccg ccgtactggc caagaaggcg aggacggcat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page