(data stored in ACNUC7421 zone)

EMBL: CP002047.PE499

CP002047.PE499       Location/Qualifiers
FT   CDS_pept        complement(586952..587623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00499"
FT                   /product="hypothetical protein"
FT                   /note="COG1652 Uncharacterized protein containing LysM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03620"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C9"
FT                   /protein_id="ADI03620.1"
FT                   /translation="MSVTPVSFARQGSARARLEIVRPVIADERQRRIPLRFNPTDYKLS
FT                   KSNTFAEITIPGLETPPLQYVRGGTETLTVQALVDTSDTLENVRKAYVNAVRNLLRPDS
FT                   REHAPPVVRFVWDEEVFTGVVEKLDVNYQLFRPDGVPLRAMLDLSLKEFRPAATQIAET
FT                   PRSSPTVEKSYVVRRGDTLSSISAALYRRPDAWRELARANGISDPRELRPGRVLTVPRL
FT                   A"
     atgagcgtca caccggtgtc cttcgcacgt cagggctccg cccgggcccg cttggagatc        60
     gtccggccgg tgatcgccga tgagcggcag cggcggatcc cgctgcggtt caaccccacc       120
     gactacaagc tgagcaagag caacacattc gccgagatca ccatccccgg cctggagaca       180
     ccgcccctgc agtacgtccg cggcggcacg gagaccctga cggtccaggc gctggtggac       240
     acctccgaca ccctggagaa cgtacggaag gcctacgtca acgcggtgcg caacctgctg       300
     cggcccgaca gccgcgaaca cgcaccgccg gtcgtccggt tcgtctggga cgaggaggtc       360
     ttcaccggtg tggtggagaa gctggacgtg aactaccagc tgttccgccc ggacggggtg       420
     ccgctgcggg ccatgctgga cctctcgctc aaggagttcc gcccggccgc cacgcagatc       480
     gccgagaccc cgcgctcctc gcccacggtg gagaagagct atgtggtgcg ccgcggcgac       540
     acgctcagct ccatctccgc cgcgctgtac cggcggcccg acgcctggcg ggagctggcg       600
     cgggccaacg gcatcagcga tccacgggag ctgcgacccg gccgggtgct gaccgtgccc       660
     cggctggcgt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page