(data stored in ACNUC7421 zone)

EMBL: CP002047.PE5

CP002047.PE5         Location/Qualifiers
FT   CDS_pept        complement(3050..4615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03126"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU9"
FT                   /protein_id="ADI03126.1"
FT                   /translation="MYSYSFWGALAEAPGLSPAQQRAIAEALTQQHPDTAARFFARPDL
FT                   DHETRDHMVRDTRNPRVLAALLSTPVVTGSHLMTAAKVLGAEAVLLEAIRSRCDPKEVL
FT                   LPLINQLDHRVARRVGMAEWGITSPIRCALIRAAACPPAALSSRSKDLTEAEREELHAA
FT                   VKAWHDDVWALLEAAPARPLWPELVRDANSGRLITNLLLNRADDLDDPVLLACLESAFP
FT                   KDAGKDADPDDLYSGVFGATVNLGRLVSITERHPRAFLLHGPTLREVIAAATGELTREI
FT                   RKEGIYESSWDVFDALASVCTSPALLADAAQCLSQATPPTWQQRQPPAPKWTAARSQAA
FT                   DALARNPFCPAEALALLAPFLSDATAAHFVEHPDEQVRDAATRIVDQAVERIHQTGPAA
FT                   PKQRNLLAGPTVPADESLAQQDDPVAALSAFLPLKGPAERRRETARAILDSRYADVSHL
FT                   RQLPAALVLAHTAHAPVVAALLLQELGDHSQAWDRFRGNVLGLTPKAPKTLGVLIQEAT
FT                   ADTP"
     atgtactcgt actccttttg gggcgcgctc gcggaagctc ccggcctgtc gccggcgcag        60
     cagcgtgcca tcgccgaagc tctcacccag cagcatccgg acaccgccgc gcgattcttt       120
     gcccggcctg atctcgatca cgagacccgt gaccacatgg tgagggacac ccgtaacccg       180
     cgtgtactgg cggcccttct gtcgacgccg gtggtgaccg gcagtcacct gatgactgcg       240
     gccaaggtgc tcggtgccga ggcggtactg ctggaggcca tacggtctcg ttgcgacccg       300
     aaagaagtgc tgcttccgct catcaaccag ctcgatcacc gtgtcgcacg ccgtgtgggc       360
     atggcagagt ggggtatcac ctcgccaatc cgctgcgcgc tgatccgtgc ggccgcatgt       420
     cctcccgccg cgctcagcag ccgctccaag gacctcaccg aagcggaacg cgaggagctg       480
     cacgccgcgg tcaaagcgtg gcatgacgac gtgtgggcac tgctcgaagc agcacccgcc       540
     cgtcctctgt ggccggagct cgtacgcgat gccaactccg gccggctgat cacgaacctt       600
     cttctcaacc gcgccgacga cctcgacgac ccggtgctgc tggcctgcct ggaatcggcg       660
     ttccccaaag acgcaggcaa ggacgcagac ccggacgacc tctactccgg cgtcttcggc       720
     gcaacggtga acctcggcag actggtcagc atcactgaac ggcatccgcg cgcattcctg       780
     ctccatggcc ccacccttcg ggaggtcatc gccgctgcca ccggcgaact gacacgcgag       840
     atccgcaaag aaggcatcta cgaaagcagc tgggacgtat tcgacgcact cgccagcgtg       900
     tgcacttcgc ctgctctact cgcggacgcc gcccagtgcc tcagccaggc caccccgccg       960
     acctggcaac agcgacagcc cccggcgccg aagtggactg ccgcacgctc gcaagctgcc      1020
     gatgccctgg cccgcaaccc gttctgcccg gccgaagcgc tcgccctgct cgctccgttc      1080
     ctcagcgacg ccaccgccgc ccactttgtc gaacaccccg acgagcaggt ccgtgacgct      1140
     gcgacccgca tcgtcgacca ggctgtggag cgcatccacc aaaccgggcc ggcagcaccg      1200
     aaacagcgca acctgctggc cgggcctact gtgccggcgg acgaaagcct cgcccagcag      1260
     gatgatccgg tggcggcact gtcggccttc ctgcccctca aaggccccgc agagcgccgc      1320
     cgcgagaccg ctagagccat cctggactcc cgctacgccg acgtatccca tctcaggcag      1380
     ctgcccgcag ccctggtcct ggcccatacc gcgcacgcgc cggtggtggc ggcactgctg      1440
     cttcaggaac tgggcgacca cagccaggcc tgggaccgct tccgcggcaa cgtgcttggg      1500
     ctgacaccca aggctcccaa aaccctggga gtcctgatcc aagaggcaac cgccgacacg      1560
     ccctga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page