(data stored in ACNUC7421 zone)

EMBL: CP002047.PE50

CP002047.PE50        Location/Qualifiers
FT   CDS_pept        45989..47506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03171"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI0"
FT                   /protein_id="ADI03171.1"
FT                   /translation="MHHILCGLAANPALSSELVDRLISIADDDIAAGLACRADLSRAQA
FT                   VALAERVDESAVRLAYEGRLTAADIDPAVWPDAALALLDQGVGRPEWARRLAADPVRER
FT                   REQLAACRGLPSDVVDTLAADPDVRVVAELALWTTPDVAARLAAHPHAEVRRAVASNEA
FT                   TPPAALVALVTGEGLPAARHCLVCDREETPFIHDPQCLRPDCDLLPGASCDGSHESTVH
FT                   AMREAALRNPATPVEAVVGFVDYPSMQLRWALAARQDLPQQACARLASDPTPGVRADVA
FT                   ENPAIDDALIRALAGDRDPDVRRRLAHHPRVPLDVLTHLARTTKIGATLLPRIAASSPT
FT                   EVEELATSPDPATRMLVAQRRDLPPEIRDRLADDPDAKVVKALAPHPGLTEAQLRTMVD
FT                   RHGVRVLAKVAANPDAPPALLEDLLRHEPAAQKVFREVARHRGATASALLACLTDKRAR
FT                   PVAAGHPALPPPVIAELLADTDWQVAEAAAANPSLPLAVISDLVGRQ"
     gtgcatcaca tcctgtgcgg gctcgccgcc aaccccgcct tgtcgtccga gctggtcgac        60
     cggctgatat ccatcgcgga cgacgacatc gccgcgggcc tcgcctgtcg cgcggacctc       120
     agccgtgcac aggcggtcgc gctggccgag cgcgtcgacg agagcgcggt gcggctcgcg       180
     tacgagggtc ggctgaccgc cgccgacatc gatcccgctg tctggccgga tgccgccctc       240
     gccctgctcg accagggtgt cggccgcccg gagtgggcgc gtcgccttgc ggcggatccg       300
     gtccgtgagc gtcgggagca gctggcggcc tgccgcggcc tcccgtccga cgtggtggac       360
     acgctcgcgg cggacccgga cgtacgtgtc gtcgccgagc ttgcgttgtg gaccacccca       420
     gatgtggccg cgagactcgc ggcgcatccg cacgccgagg tccgccgcgc ggtggcgagc       480
     aacgaggcga cacccccggc cgcactggta gcgttggtga ccggggaggg gctgcctgcg       540
     gcgcgacact gtctggtctg tgaccgcgag gagaccccct tcatccacga tccgcagtgt       600
     ctacggcccg actgcgatct gctgccgggc gcctcctgcg acggctccca cgagtccacc       660
     gtccacgcta tgcgggaggc tgcactccgt aaccctgcca cccccgtcga agccgtcgtc       720
     ggcttcgtgg attatccgtc gatgcagttg cgctgggcgc tcgccgcccg tcaggacctg       780
     ccccagcagg cctgcgcacg gctcgcttcg gaccccactc ccggtgtccg cgccgacgtt       840
     gccgaaaatc ccgcgatcga cgatgccctg atccgtgcgc tggccggcga ccgtgacccc       900
     gacgtgcgcc gcaggctcgc acaccatccc cgcgtaccgc tcgacgtgct cacccacctg       960
     gcccgaacta ccaagatcgg cgccaccctt ctgccccgta ttgccgcctc ctctcccacc      1020
     gaggtcgaag agctggccac gtcgccggac ccggccaccc gaatgctcgt ggcccaacga      1080
     cgcgatttgc cgcccgagat acgcgaccgg ctggccgacg accccgacgc gaaggtggtc      1140
     aaggccctcg ctccgcaccc gggcctcacc gaagcgcagt tgcgcaccat ggtcgaccga      1200
     cacggtgtcc gtgtcctggc caaggtggcg gccaacccag acgcgccccc ggcgctgctg      1260
     gaggacctgc ttcggcacga accagcggcg cagaaggtgt tccgtgaggt tgcccgacat      1320
     cgcggggcga cggcctcggc gctgctcgcc tgcctgacgg acaagcgggc gagacccgta      1380
     gccgccggcc acccagcact tccgccaccg gtcatcgcag agctgctcgc cgacacggac      1440
     tggcaggtag cggaagcagc agcagccaac ccgtccctgc cgctcgccgt gatatcggat      1500
     ctggttggcc ggcagtga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page