(data stored in ACNUC7421 zone)

EMBL: CP002047.PE500

CP002047.PE500       Location/Qualifiers
FT   CDS_pept        complement(587620..587811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03621"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D0"
FT                   /protein_id="ADI03621.1"
FT                   /translation="MTGVPKVTIHQLEVRFQVDGDDGAVFTRLFNKHIQAWAKLYEDQC
FT                   ARARHTESERRFGDGEAS"
     gtgaccggcg tgccgaaggt gaccattcac cagctcgagg tccggttcca ggtggacggc        60
     gacgacggcg ccgtgttcac ccgcctgttc aacaagcaca tccaggcatg ggcgaagttg       120
     tacgaggacc agtgcgcgcg cgccaggcac accgagagcg aacggcgctt cggggacggg       180
     gaggcgtcat ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page