(data stored in ACNUC7421 zone)

EMBL: CP002047.PE501

CP002047.PE501       Location/Qualifiers
FT   CDS_pept        complement(587808..588326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03622"
FT                   /db_xref="GOA:D7C0D1"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D1"
FT                   /protein_id="ADI03622.1"
FT                   /translation="MTLDPLPKYRFLVTLDPGDAYLPPAQALLLPLAASGAFQEVTGLG
FT                   AQLEVVSYPEGGRNDSVHQLPLRHSWNRITLKRGVVRDPGLWAWYQAGLADSLGARRDG
FT                   AVIVLGPDGVPGAAWAFHGGLAAKWSGPDLHAEQNAIAIESLEIAHEGLTKVLQDAAAN
FT                   ALPRLSQGR"
     atgaccctgg atccactgcc caaataccgc ttcctggtca ccctcgaccc cggcgacgcg        60
     tatctgccgc ccgcgcaggc gctgctgctg ccactggccg cctccggcgc gttccaggag       120
     gtcaccgggc tcggcgcgca gctggaggtg gtgagctacc cggagggcgg ccgtaacgac       180
     tcggtccacc aactgccgct gcgccactcg tggaaccgga tcacgctcaa gcgcggggtg       240
     gtgcgcgacc cggggctgtg ggcctggtac caggccgggc tcgccgattc gctgggcgcc       300
     cgccgcgacg gcgcggtgat cgtgctcggc ccggacgggg tgcccggcgc ggcgtgggcc       360
     ttccacggcg ggctcgccgc caagtggagc ggcccggacc tgcacgcgga gcagaacgcg       420
     atcgccatcg agtcgctgga gatcgcgcac gaggggctga cgaaggtcct gcaggacgcc       480
     gcggcgaacg ccttgccgcg cctgagtcaa gggaggtga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page