(data stored in ACNUC7421 zone)

EMBL: CP002047.PE502

CP002047.PE502       Location/Qualifiers
FT   CDS_pept        complement(588323..589816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00502"
FT                   /product="putative phage tail sheath protein"
FT                   /note="COG3497 Phage tail sheath protein FI"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03623"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D2"
FT                   /protein_id="ADI03623.1"
FT                   /translation="MVGEALPGVSLTYRPRGSDTEPLRTDVAAFLGRLRRGPVATPVRV
FT                   ESWNDVVGAFGPPDGAFATPYALRGFFENGGRTAWVLRVSGPATTARTRWPAGPLGGLA
FT                   ATDFQVVATSPGAWANGGRVAIRYQASTVAGPAGVGVRITMPGEAPETFAGLPLADVAD
FT                   RLTASRYIRLIPDGPPPPPGRPGPISMSWDLTLTGGAESPPTRGEYADAVTLQAELPEP
FT                   ALVALPDLGADLSGSAHTELVLELLRSVAPLHDRLAVLDVPPRLSSVDEAVDWAGSLAA
FT                   GGDSALLGCAAVYHPPLRTPDGQALRTVPASGHVLGVIARLDAERGAHHTPAGAVILEA
FT                   VDLAAEYPEPQQVRLFDAGLDLIRCTRGRGLMVWGGRTLSADPGTRYIAHRRLVHLLVR
FT                   AIRRVASPLVFDVNSPELRLTLVRALTSVLLSAFRAGALAGDRPEQAFRVVCDDTNNPP
FT                   EQDPGQLVCEIEVAPAVPMEFIRLRLVLGQDRGLEVIEA"
     atggtcggcg aagcgctccc cggggtatcc ctgacgtacc ggccacgcgg ttcggacacc        60
     gagccgctgc gcacggatgt ggcggcgttc ctgggccggc tccgccgggg cccggtcgcc       120
     actccggtgc gcgtggagag ctggaacgat gtcgtgggcg ccttcggccc gccggacggc       180
     gccttcgcca ccccgtacgc gctgcgcggc ttcttcgaga acggcggccg caccgcctgg       240
     gtgctccggg tgtccgggcc ggccaccacg gcccggaccc ggtggccggc cggtccgctc       300
     ggcggcctgg ccgccacgga cttccaggtg gtcgccacca gccccggagc ctgggccaac       360
     ggcgggcgcg tcgcgatccg ttaccaggcc agcacggtcg ccgggccggc cggcgtgggc       420
     gtacggatca cgatgcccgg cgaggcgccc gagaccttcg ccggactgcc gctcgccgat       480
     gtggccgacc ggctgaccgc atcccgctat atccggctga tcccggacgg gccgccaccg       540
     ccaccggggc ggcccggccc gatctcgatg tcctgggacc tgacgctcac gggcggcgcc       600
     gaatcgccgc ccacccgcgg cgagtacgcg gacgccgtga cgctccaggc cgaactgccg       660
     gaaccggcgc tggtggcgct gcccgacctg ggcgcggacc tgtccggcag cgcgcacacc       720
     gagctggtgc tggaactgct gcggagcgtg gcacccttgc acgaccgcct cgccgtcctg       780
     gacgtaccgc cccggctgtc ctccgtggac gaggcggtcg actgggcggg ctcgctcgcg       840
     gccggcggcg acagcgcgct gctcggctgc gccgccgtct accacccgcc gctgcgcacc       900
     cccgacggac aggccctgcg gaccgtcccg gcgtccgggc acgtcctggg cgtcatcgcc       960
     cgcctcgacg ccgagcgcgg ggcgcaccac acgcccgcgg gcgccgtgat cctggaggcg      1020
     gtcgacctcg cggccgagta ccccgagccg cagcaggtcc ggctcttcga cgcggggctc      1080
     gacctgatcc gctgcacccg cgggcggggg ctgatggtgt ggggcggacg caccctgtcc      1140
     gccgacccgg gcacccgcta catcgcgcac cgccgactgg tgcatctgct ggtgcgcgcc      1200
     atccggcggg tggcgagccc gctggtgttc gacgtcaact cgcccgagct gaggctgacg      1260
     ttggtacggg cgctgacctc cgtactcctg tcggccttcc gggccggggc gctcgccggc      1320
     gaccggcccg agcaggcgtt ccgcgtggtg tgcgacgaca cgaacaaccc gcccgaacag      1380
     gacccggggc agctggtctg cgagatcgag gtcgccccgg ccgtcccgat ggagttcatc      1440
     cggctgcgtc tcgtactcgg ccaggaccga ggtctggagg tgatcgaggc atga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page