(data stored in ACNUC7421 zone)

EMBL: CP002047.PE503

CP002047.PE503       Location/Qualifiers
FT   CDS_pept        complement(589818..590273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00503"
FT                   /product="hypothetical protein"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03624"
FT                   /db_xref="GOA:D7C0D3"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D3"
FT                   /protein_id="ADI03624.1"
FT                   /translation="MPPVTRDDPYASYNFQIIVTNVSDDGVAVSGSFTEVSGLELEVPP
FT                   IEYRTGSEDITVRKIPGLKKFTNLTFKRGITGHVGFWNWVVEALNGKVRRTSGSIVLLD
FT                   ENRQETMRWNFDRGWPTKYTGPTLSATKNEIAMETLVLAVEKLEIDV"
     atgccgcccg ttaccaggga cgatccatac gcgtcctata acttccagat catcgtgacc        60
     aacgtcagcg acgacggggt cgcggtgagc gggtccttca ccgaggtgag cgggctggag       120
     ctggaggttc cgccgatcga gtaccgcacc gggagcgagg acatcaccgt ccgcaagatc       180
     ccggggctga agaagttcac caacctcacc ttcaaacgcg gcatcaccgg ccacgtcggt       240
     ttctggaact gggtggtcga agcgctcaac ggcaaggtgc ggcgcacctc cggctcgatc       300
     gtgctgctgg acgagaaccg ccaggaaacg atgcgctgga acttcgaccg cggctggccg       360
     accaagtaca ccggcccgac gctcagcgcc accaagaacg agatcgccat ggagaccctt       420
     gtcctggcgg tcgagaagct ggagatcgac gtctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page