(data stored in ACNUC7421 zone)

EMBL: CP002047.PE505

CP002047.PE505       Location/Qualifiers
FT   CDS_pept        complement(592569..593297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03626"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D5"
FT                   /protein_id="ADI03626.1"
FT                   /translation="MPLAGSTLYSPAWFIPFDDYARRVRSAGVAVQLDRFDDEGDGDGA
FT                   WLPLDDVPVRTPSAALAYPGLGRCGEPWAARPRRHRARFAAAGYQPLYPADEQPYSADL
FT                   VGVEFLVYPYDDAHPPAVVTEPRLVRLLPSVSFPYPPGLRTVHGAVVDATTRTPIANAL
FT                   VEARGRTSRDLTPWHERTLSDAAGAFRLALRWEGEKADEHAVEETFRLEATERPGRSGS
FT                   LVVRLPQDIERRHVIEIREQ"
     atgccgctgg caggttcgac gctctacagc ccggcctggt tcataccgtt cgacgactac        60
     gcgcggcggg tgcgcagcgc gggggtggcg gtccagctgg accgattcga cgacgagggc       120
     gacggcgacg gcgcctggct gccgctggac gacgtgccgg tgcgcacccc cagcgccgcc       180
     ctcgcctatc cgggtcttgg cagatgcggt gagccgtggg cggcccggcc gcggcggcac       240
     cgcgcgcgct tcgcggccgc cggctaccag ccgctgtacc cggccgatga gcagccgtac       300
     tcggccgatc tggtgggtgt cgagttcctg gtgtacccgt atgacgacgc ccacccgccc       360
     gcggtggtga ccgagccgcg cctggtccgg ctgctgccca gcgtctcctt cccctatccg       420
     ccggggctgc gcacggtgca cggcgccgtg gtcgacgcga ccacccgaac accgatcgcc       480
     aatgcgctgg tcgaggcccg gggtcggacc agccgggatc tgacgccatg gcatgagcgc       540
     accctgtccg acgccgcggg cgccttccgg ctggccctgc ggtgggaggg cgagaaggcc       600
     gacgagcacg ccgtcgagga gacgttccga ctggaggcca ccgaacggcc gggccggtcc       660
     ggatcgctgg tcgtgcggct gccccaggac atcgagcgcc ggcacgtcat agagatccgc       720
     gagcagtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page