(data stored in ACNUC7421 zone)

EMBL: CP002047.PE506

CP002047.PE506       Location/Qualifiers
FT   CDS_pept        complement(593306..593884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03627"
FT                   /db_xref="InterPro:IPR025351"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D6"
FT                   /protein_id="ADI03627.1"
FT                   /translation="MGDFGVIADVSTVIVETLTQALRGLSQVEPPIAELNDLSETVQTP
FT                   PPKLTVFLYEIAEDPTSRNRPPVRSQPPDPPNVRKPPMALLLRYLITPWGGDPATQHRM
FT                   LGRALQTFYDDAILDGVQLSGSLAASTDSLHLSLTPLTLDQKSWVWYAIQKPYRLSLNY
FT                   EVRVVNLDSAVETAVRPVNSRAISGAAMP"
     atgggtgact tcggcgtcat cgccgacgtc tcgacggtca tcgtggagac cttgacccag        60
     gccctgcgcg ggctcagcca ggtggaaccg ccgatcgcgg aactcaacga tctctccgag       120
     acggtacaga cacccccgcc gaaactcacg gtgttcctct atgagatcgc cgaggacccg       180
     acgtcgcgca atcggccgcc ggtgcgctcc cagccacccg acccgccgaa cgtccgcaag       240
     ccgccgatgg ccctgctgct gcggtacctg atcaccccct ggggcggtga cccggcgacc       300
     cagcaccgga tgctcgggcg ggccctgcag acgttctacg acgacgcgat cctggacggc       360
     gtacagctgt ccggcagcct ggcggcgagc accgactcgc tgcacctcag cctgaccccg       420
     ctcaccttgg accagaagtc ctgggtctgg tacgcgatcc agaagccgta ccggctgtcg       480
     ctgaactacg aggtgcgcgt ggtcaacctg gactccgccg tcgagacggc ggtccgcccc       540
     gtgaacagcc gggccatcag cggggcggcg atgccatga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page