(data stored in ACNUC7421 zone)

EMBL: CP002047.PE508

CP002047.PE508       Location/Qualifiers
FT   CDS_pept        594487..595323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00508"
FT                   /product="transcriptional regulator, SARP family protein"
FT                   /note="COG3629 DNA-binding transcriptional activator of the
FT                   SARP family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03629"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D8"
FT                   /protein_id="ADI03629.1"
FT                   /translation="MVDHKRVPVSSSAQRLLAFLALQDMPRTRTYVAGTLWPDVTASRA
FT                   NANLRSSLWRATRTGHQVIDASTQELAISKHIDVDLHTAARHAHCLLDMSRSCDDILTA
FT                   QTRADLSADLLPEWSENEWVLIEQEQYHELRLYALEAMTERLTAAGRHGEAVAAGLAAV
FT                   RAEPLRESAHRALMNAHLTAGNRGAALLQYEQCCRVLHDELGLEPSPTLRNLVSPHTEA
FT                   GALRTPARRVVRHPASDALRDATDEAERVAISPAEPRRLPRSRRAGTGPPMPSHPQ"
     ttggtcgatc ataagcgcgt tcccgtttct tccagcgccc aacgcctcct cgcgttcctg        60
     gccctgcagg acatgccgcg gacccgtacc tatgtggccg gcacgctgtg gccggacgtc       120
     acggcctccc gcgccaacgc caacctccgg tcctccttgt ggcgcgcgac acgcacggga       180
     catcaggtca tcgacgcgtc cacacaggaa ttggcgatct ccaaacacat cgacgtggac       240
     ctccacacgg cggcgcggca cgcacactgc ctgctcgaca tgtcgcgctc gtgcgacgac       300
     atcctgaccg cacagacccg ggcggacctc tcggccgatc tgttacccga gtggtccgag       360
     aacgagtggg tgctgatcga gcaggagcag taccacgaac tcaggctgta cgccctggag       420
     gcgatgaccg aacggctcac cgcggcgggc cgccacggcg aagccgtcgc cgccgggctc       480
     gccgccgtcc gcgcggagcc cctgcgggaa agcgctcatc gcgccctcat gaacgcacat       540
     ctcaccgcgg gcaacagagg cgcggctctg ctgcagtacg aacaatgctg ccgcgttctg       600
     cacgacgaac tgggcctgga gccctccccg acactgcgca acctggtctc gcctcacacc       660
     gaggcgggcg ccctcaggac cccggcgcgt cgggtcgtcc gccacccggc gagcgatgcc       720
     ctgagggacg ccacggacga agccgagcgc gtcgccatct ccccggccga gccgcgccgc       780
     ctcccaagat ccagacgcgc cggcaccggc ccgcccatgc cgtcgcaccc tcaatag          837
//

If you have problems or comments...

PBIL Back to PBIL home page