(data stored in ACNUC7421 zone)

EMBL: CP002047.PE509

CP002047.PE509       Location/Qualifiers
FT   CDS_pept        595484..596761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00509"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03630"
FT                   /db_xref="GOA:D7C0D9"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D9"
FT                   /protein_id="ADI03630.1"
FT                   /translation="MVTLGFLIALEIAARRYTGQPGPITNQAREVIFAPKPGPLYGGMA
FT                   LMMVVLTWRQRFIALGAAIGIDIVFVLVRWAVGADVPADHFFGNGALWVMLGCGVIAVT
FT                   RRTGRERALLLKGVGLGLLLVAGRKTGDTWLLITAKTRPTVLDEYVATADHALGNPSWL
FT                   AGRILRATEPIGTHLLDWVYGELAVAAIVVALYQLRNVAVERRFPRHHLLRTFLVIGLL
FT                   GPAIYMIFPVVGPIFAYGPGTSGTGGLQWAVANLWPNTLPPIKPPHPVPYDGITPRNCM
FT                   PSLHTAWALAIFIHSRKGPWFLRFAGAFWLIATLGATLGFGYHYGVDLVAGVVFALTIE
FT                   AALRTFDRGWDRSGLQLVAYGTTVFAALLVLYRYLPMEMATHPWVFGPLLILAMASVIY
FT                   GYVRTTKRWEPTSAPARQPEPQPELV"
     ttggtgaccc tcggattcct catcgcgctg gagattgccg cgcgtcgcta caccggccaa        60
     ccggggccga tcaccaatca ggcgcgagag gtgatattcg cccccaaacc ggggccgctg       120
     tacggcggta tggcgttgat gatggtggtg ctcacctggc ggcaacggtt cattgcgctt       180
     ggcgccgcga tcggcatcga catcgtcttc gtactggtgc ggtgggcggt cggcgccgac       240
     gtgcccgctg accatttctt cggcaacggc gcgttgtggg tgatgctggg ctgcggagtc       300
     atcgcggtca cgcgccgcac cggccgggaa cgtgccctgc tgctgaaggg cgtcggtctt       360
     ggcctgctgc tggtggccgg ccgtaagacc ggcgacacct ggctcctgat cacggcgaag       420
     acccgcccga ccgtgctcga cgagtacgtg gcaaccgccg atcacgcgct gggcaacccg       480
     tcgtggctgg caggccggat tctcagggcc accgagccga tcggcaccca ccttctcgac       540
     tgggtctacg gtgagctcgc ggtggccgcg atcgtcgtcg cgctgtacca gctgcgcaac       600
     gtggcggtcg agcgccgctt ccccagacac catctgctgc gcacctttct ggtgatcggc       660
     ctcctcgggc cggccatcta catgatcttc ccggtggtcg gaccgatctt cgcctacggc       720
     ccgggcacct ccggcaccgg cggtctgcag tgggcggtgg ccaacctgtg gccgaacacg       780
     ctgccaccga tcaaaccccc gcacccggtg ccgtacgacg ggatcacccc ccgcaactgc       840
     atgcccagcc tgcacacggc gtgggctctc gcgatcttca ttcattcccg caagggccca       900
     tggtttctgc gattcgccgg cgcgttctgg ctcattgcca cgctcggcgc gacgctgggc       960
     ttcggctacc actacggcgt ggatctcgtc gcgggtgtgg tgttcgcgct cacgatcgag      1020
     gcggctctgc gcacgttcga ccgtggctgg gaccggtcag gacttcagct ggtcgcctac      1080
     ggcacaacgg tcttcgccgc gctcctggtg ttgtaccgct atctgccgat ggagatggcc      1140
     acgcatccgt gggtgttcgg accacttctc attctggcga tggcctcagt gatctacggc      1200
     tatgtacgga ccaccaaacg gtgggaaccg acgtccgcac cagcgcggca accggaaccg      1260
     caacccgaac tggtctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page