(data stored in ACNUC7421 zone)

EMBL: CP002047.PE511

CP002047.PE511       Location/Qualifiers
FT   CDS_pept        complement(599855..601987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00511"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG2274 ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03632"
FT                   /db_xref="GOA:D7C0E1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022514"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E1"
FT                   /protein_id="ADI03632.1"
FT                   /translation="MLQMEALECGAASLAMVLGHYGRHVPLEELRIACGVSRDGSRAGN
FT                   LLRAARSYGLRAKGMQMEPEALAEEVRAPAILFWNFNHYVVYDGMGRRFGKRGVHIDDP
FT                   DKGRRFVPVEEFNTSFTGVVLVFEPEESFRRGGRRPGVLGALPSRMRGTTGTLLASLLA
FT                   SLLLVAVGAAVPALSRTFIDNFLIGGQDSLLGPLFASMAVAVVLTAVLTGVQQANLLRG
FT                   RIISSTLSSARFLRHLLRLPVTFFAQRSPADLVQRLRSNDTVAETLARDLAAAAVDGVV
FT                   VVLYAFLLWTYDPQLTLVGVGLALLNVVAMRVVIRLRATRTQKLRADIARLTTTSYTGL
FT                   QLIETVKATGGETGYFRRWAGQHAITLEEQQRLGVPSAVLAVVAPTLATLNSALILWIG
FT                   GLRAVEGHISIGLLVAFQALVARFTAPITRLNGVAGRIQDFSADVARLKDVENFPADSL
FT                   YTRDEPRADTRRLTGQVTLENITFGYSPLDQPLLRDFSLSVGPGRQVALVGASGSGKST
FT                   VSRLVSGLYTPWEGVIRIDGQRLEDIPRGALAASVSFVDQDVFLFEGTVRDNVALWDPS
FT                   IPDDAVVDALRDAALYDDVIARRPEGIHCRVEQDGRNFSGGQRQRLEIARALVRRPSVL
FT                   VLDEVTSALDARTEQIVMDSLRRRGCACVVIAHRLSTVRDSDEILVLNRGTVVERGRHE
FT                   DLAAAGGPYAELMKEH"
     gtgctccaga tggaggccct ggagtgcggt gcggcgtcgc tcgccatggt gctcggacac        60
     tacggacgcc atgtgccgct ggaggagctg cggatcgcct gcggtgtgtc ccgggacggg       120
     tcgcgcgccg gcaatctgct cagggccgcc cggagttacg gtctgcgcgc caagggcatg       180
     cagatggagc ccgaggccct tgcggaggag gtcagggccc cggcgatcct gttctggaac       240
     ttcaaccact acgtcgtcta cgacggtatg ggacggcggt tcggcaagcg cggcgtccac       300
     atcgacgacc ccgacaaagg gcgccgtttc gtccccgtcg aggagttcaa caccagcttc       360
     accggagtgg tcctggtctt cgaacccgag gagtccttcc gccggggcgg gcgccgcccc       420
     ggtgtgctgg gcgccctgcc ctcgcgtatg cggggcacca ccggcaccct gctggcctcg       480
     ctgctggcca gcctgctgct ggtggcggtg ggggccgcgg tcccggcgct cagccgcacc       540
     ttcatcgaca acttcctgat cggcggccag gactcgctgc tggggccgct gttcgcgtcc       600
     atggccgtgg cggtggtgct cacggccgta ctgaccggtg tccagcaggc gaatctgctg       660
     cgcggacgca tcatctcctc caccctcagc agcgcgcgtt ttctgcggca tctgctgcgg       720
     ctgcccgtca ccttcttcgc ccagcgcagc ccggcggacc tggtccagcg gctgcgttcc       780
     aacgacaccg tcgccgagac gcttgcccgc gatctggccg ccgcagccgt cgacggggtc       840
     gtggtggtcc tctacgcctt cctgctgtgg acgtacgacc ctcaactcac cctggtcggc       900
     gtcgggttgg cgctgctcaa cgtggtggcg atgcgggtgg tgatacggct gcgggccacc       960
     aggacccaga agctgcgggc cgacatcgcg cggctgacca ccacgtcgta caccggtctc      1020
     cagctcatcg agacggtgaa ggccaccggc ggggagaccg gctacttccg ccgctgggca      1080
     ggtcagcacg ccatcaccct ggaggagcag cagcgcctcg gtgtgccgag cgccgtactg      1140
     gccgtggtcg cccccaccct cgccacgctc aacagcgccc tcatcctctg gatcggcggg      1200
     ctgcgggccg tcgagggcca tatctcgatc ggtctgctgg tggccttcca ggcgctggtg      1260
     gcccgcttca ccgcgcccat cacccggctc aacggagtgg ccggccgcat ccaggacttc      1320
     tccgccgacg tggcccggct caaggacgtg gagaacttcc cggcggactc cctctacacc      1380
     cgcgacgagc cgcgcgcgga cacccgtcgg ctgaccgggc aggtgacgct ggagaacatc      1440
     accttcggct acagcccgct ggaccaaccg ctgctgcgcg acttctcgct gtccgtcggc      1500
     cccggccggc aggtggcgct ggtcggcgcc tccggcagtg gcaagtccac ggtctcccgg      1560
     ctcgtctccg gtctctacac cccctgggag ggggtcatcc gcatcgacgg acagcggctg      1620
     gaggacatcc cccgcggggc gctggccgcc tcggtctcct tcgtcgacca ggacgtcttc      1680
     ctgttcgagg gaacggtgcg ggacaacgtg gcgctgtggg atccgtccat cccggacgac      1740
     gcggtggtgg acgccctgcg ggacgccgcg ctctacgacg atgtgatcgc acggcgcccg      1800
     gagggcatcc actgccgggt ggagcaggac ggccgcaact tctccggagg ccagcggcag      1860
     cggctggaga tcgcccgcgc cctggtccgc cgccccagcg tgctggtgct tgacgaggtc      1920
     accagcgccc tggacgcgcg gaccgagcag atcgtcatgg acagtctgcg ccgccgcggc      1980
     tgtgcgtgtg tggtgatcgc ccaccggctg agcaccgtgc gggacagcga cgagatcctg      2040
     gtcctgaacc gcggcacggt tgtcgaacgc ggacgtcacg aggaccttgc cgccgccgga      2100
     ggcccgtacg ccgagctgat gaaggagcac tga                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page