(data stored in ACNUC7421 zone)

EMBL: CP002047.PE512

CP002047.PE512       Location/Qualifiers
FT   CDS_pept        complement(602146..602952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00512"
FT                   /product="hypothetical protein"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03633"
FT                   /db_xref="GOA:D7C0E2"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E2"
FT                   /protein_id="ADI03633.1"
FT                   /translation="MQFRQQALAKLQSAEDIDLPVRYARPQGWLALAVTLVVMAGAAVW
FT                   AVTGTVSNTLETTGILTHGQGSYVLQSPIAGQVTSVLAQEGSTLRAGAPLLKVRTARGT
FT                   TVVRTIAAGRLTTLSVSIGSVLATGANVASVERVRHSGDPLVATLYVPADRAASVRPGA
FT                   SVDLSVQSVPTQTYGVLRGEVQTVGRTALSRQQIGSYLGAEQLGEEFSKHGPPVAVQVR
FT                   LHRTSATRSGYRWSSPEGPPFSLGSMTLANGTIHLAAHHPIDWLLP"
     gtgcagttcc gccagcaggc ccttgccaag ctgcagtcgg cagaggacat tgatctgccg        60
     gtgcgctacg cccgccccca aggatggctg gcactggcgg tcacactggt ggtcatggcc       120
     ggcgccgccg tatgggccgt cacgggcacc gtgtcgaaca ccctggagac caccggcatc       180
     ctcacccacg ggcagggcag ctatgtgctg cagagcccca tcgcggggca ggtgacctcc       240
     gtcctcgcac aggagggcag caccctccgg gcgggcgcgc cgctgctgaa ggtccgcacc       300
     gcccgcggta ccacggtggt gcgcaccatc gccgccggcc ggctcaccac cctctccgtc       360
     tcgatcggct ccgtcctcgc caccggcgcg aacgtcgcct ccgtggaacg cgtacgccac       420
     tccggcgacc cgctggtcgc caccctgtac gtaccggcgg accgggcggc ctcggtgcgg       480
     ccgggggcgt cggtcgacct cagtgtgcag tccgtgccga cgcagaccta cggtgtgctg       540
     cgcggtgagg tccagaccgt gggtcggacc gccctgtcgc gccagcagat cggctcctac       600
     ctcggagccg agcaactcgg tgaggagttc tcgaaacacg gcccgccggt cgcggtccag       660
     gtgcgcctcc accgcacctc cgccacccgc tccggctacc gctggtcgtc ccccgaaggc       720
     ccgccgttca gcctcggctc catgaccctg gccaacggca ccattcacct ggccgcccac       780
     caccccatcg attggcttct cccgtga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page