(data stored in ACNUC7421 zone)

EMBL: CP002047.PE520

CP002047.PE520       Location/Qualifiers
FT   CDS_pept        608640..609206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03641"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F0"
FT                   /protein_id="ADI03641.1"
FT                   /translation="MTAGPLARPTAGTVTAHPDDPALRERVLRPYRTNCRYLGPAEVRL
FT                   ENEAVTASGTFRIGESCYIDDTGHFNAVEFNICFNQIAYYLIAKCAQNRLPPVFAAWTL
FT                   DDYWQRQLSDILITRFTSRFHRAIRGQEFRGELSFTDFKLRSGENGRAPLALIESECRF
FT                   WDKGGGRCTGEIQIALTNLPQGAPR"
     atgacggccg gccccctcgc gcgaccaacc gccggaaccg tcacggcaca ccccgacgac        60
     ccggctctgc gtgaacgggt gctgcgtccc taccgcacga actgccggta tctcggcccc       120
     gcggaggtac gcctggagaa cgaggccgtc accgcctccg gtacgttccg catcggcgag       180
     tcgtgctaca tcgacgacac cggccacttc aacgcggtcg agttcaacat ctgcttcaac       240
     cagattgcct actacctgat cgccaaatgc gcccagaacc ggctgcctcc cgtcttcgca       300
     gcctggacac tcgacgacta ctggcagcgt cagctctccg acattctgat cacccggttc       360
     accagcagat tccaccgcgc gatccgggga caggagttcc gcggcgagct gagcttcacc       420
     gacttcaagc tgcgctccgg cgagaacggc agggcgccgt tggccctcat cgagagcgag       480
     tgccggttct gggacaaggg cggcgggcgg tgcacgggcg agatccagat cgcgctgacc       540
     aacctgccgc agggtgcgcc gcgatga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page