(data stored in ACNUC7421 zone)

EMBL: CP002047.PE521

CP002047.PE521       Location/Qualifiers
FT   CDS_pept        609203..609598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00521"
FT                   /product="acyl carrier protein"
FT                   /note="COG3321 Polyketide synthase modules and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03642"
FT                   /db_xref="GOA:D7C0F1"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F1"
FT                   /protein_id="ADI03642.1"
FT                   /translation="MTEPANAVDLLLSLPRARRRQTLTDLVAAEVREVLLLPEDAEMGA
FT                   DVSFFDLGMTSLRLTELRQRLTRMLDRRIEIEALFEHPTSQGLTDHLAGTVLCDVFPGT
FT                   APASTPAPQNAQELPPMVQEILRNLYS"
     atgaccgaac cggcgaacgc ggtggacctg ctgctctcac tcccccgggc gcgccgcagg        60
     cagacgctga cggacctggt cgctgccgag gtcagagagg tcctgctgct cccggaagac       120
     gccgagatgg gcgccgacgt cagcttcttc gacctgggca tgacctcgct ccggctgacc       180
     gagcttcgcc agcgtctgac ccggatgctg gacaggagga tcgagatcga ggcgttgttc       240
     gaacacccga cgtcccaggg cctgaccgat catctcgcgg gcaccgtgct ctgcgatgtg       300
     ttccccggca ccgcacccgc ctccacgccc gcaccacaga acgctcagga gctgccgccg       360
     atggtccagg agattctgcg gaacctctac agctga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page