(data stored in ACNUC7421 zone)

EMBL: CP002047.PE527

CP002047.PE527       Location/Qualifiers
FT   CDS_pept        complement(620299..621843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03648"
FT                   /db_xref="GOA:D7C0F7"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F7"
FT                   /protein_id="ADI03648.1"
FT                   /translation="MSDILTFIIVPALYLALLLLYLVFVPVIAALRGAALVSELLWRYC
FT                   RLLGGVLRLRTPEFVTIPPYRPADERAHRNYFFGPATRDLRQLLTLGRRLYVRTVTDAY
FT                   RRVTADQFTAPSTHRSASVPYGLTLYLGLGVGAAAAAPVLGLLLGLHALGVALLTLGAR
FT                   LTALTLRAADRAVMILRGLPRGMLCPSCFERVPYPAYDCPRTTCRRRHADIRPGTFGLF
FT                   RRRCACDERIPTLLMLMSRDARLSGHCVHEHCGKPMNPDAGHMPELILPLIGGRAAGKT
FT                   QLMAAMVKALENTAENGGPAIRLADPESTANQRVLNEVLEIQGHTRPTQKTLPRAHSFV
FT                   RGSGRAERLVHVFDTAGERFVNREETDALRYIREARTFVFVLDPMAVGAFWTRLDPAGP
FT                   KVDRTLASTVDPEDVFSRSVQTVRTMGTRLDKARLAVAVSKRDLMTGQSALLPDRPDHS
FT                   DTTRDWLCERLGLRNLLKTMDLEFGEVRFFCTAAVADEEGRVDPSIGVFVDWCLRE"
     atgagcgaca tcctgacctt catcatcgtc cccgccctct acctggcgct gctcctgctc        60
     tacctggtct tcgtcccggt gatcgcggcc ctgcgcggcg ccgccctggt cagtgaactg       120
     ctgtggcgct actgccggct gctgggcggc gtgttgcggc tgcgcacccc cgagttcgtg       180
     accatcccgc cgtaccgccc cgccgacgaa cgggcccacc gcaactactt cttcggaccc       240
     gccacccgcg atctgcggca actgctcacg ctggggcgtc ggctgtacgt ccgcacggtc       300
     accgacgcgt accgccgggt gaccgccgac cagttcaccg caccctctac gcaccgctcc       360
     gcttcggtcc cctacggtct gaccctgtac ctgggcctcg gtgtcggcgc cgccgccgcg       420
     gcaccagtgc tgggcctgct cctcggcctg cacgcgctcg gcgtggccct gctgacgctc       480
     ggcgcccggc tgaccgcact caccctgcgg gccgccgacc gcgcggtgat gatcctgcgc       540
     gggctgcccc ggggcatgct gtgcccgagc tgcttcgaac gcgtccccta tccggcatac       600
     gactgccccc gcacgacctg ccgacgccgg cacgccgaca tccgccccgg taccttcggc       660
     ctcttccggc gccggtgcgc ctgcgacgag cggataccga ccctgttgat gctgatgagc       720
     agggacgccc ggctgagcgg ccactgcgtg cacgaacact gcggcaagcc gatgaacccg       780
     gacgccgggc atatgcccga gctgatcctt ccgctgatcg gcggccgggc cgcgggcaag       840
     acacagctga tggcggccat ggtgaaggca ctggagaaca ccgcggagaa cggcgggccg       900
     gcgatccggc tcgcggaccc cgagtcgacc gcgaaccagc gggtgctgaa cgaggtcctg       960
     gagatccagg gccacacccg ccccacccag aagacactgc cccgagccca ttcgttcgtg      1020
     cgaggcagcg gccgcgccga gcggctggtg catgtcttcg acacggccgg tgaacggttc      1080
     gtcaaccggg aggagaccga cgcgctgcgc tatatccggg aggcccgtac cttcgttttc      1140
     gtcctcgacc cgatggccgt cggcgcgttc tggacccgcc tcgacccggc aggcccgaag      1200
     gtggaccgca cactggcctc cacggtcgac ccggaggacg tgttctcgcg ctcggtgcag      1260
     accgtacgca cgatgggcac ccgcctcgac aaggcccggc tcgccgtcgc cgtcagcaag      1320
     agggacctga tgaccgggca gtccgcgctc ctgcccgacc gcccggacca cagcgacaca      1380
     actcgggatt ggctgtgcga gcggctgggg ttgcggaatc tgttgaagac gatggatctg      1440
     gagttcggtg aggtccggtt cttctgtacg gcggcggtag cggatgagga ggggcgggtg      1500
     gaccccagta ttggggtgtt cgttgattgg tgtctgcgcg agtga                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page