(data stored in ACNUC7421 zone)

EMBL: CP002047.PE529

CP002047.PE529       Location/Qualifiers
FT   CDS_pept        complement(624295..625485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F9"
FT                   /protein_id="ADI03650.1"
FT                   /translation="MARRLTCPYCYETFAPREIRFRCNSRLSRTRKQCQRRRDPVLDER
FT                   FGRRPSHDVGPDFAADGRKSTAVCPDCDGETTYRICPVCHVELPVQFGMVENRLIAMVG
FT                   ARSSGKTIYMTVLLHEMRHKIGEAFGASLMGLDDTTMRRYSSEYEDRLYRDRQMFPPTQ
FT                   TATTNANRVEPLVFRFGLRRRGLFGERPQHSVLSFFDTAGEDFNSRESVELNTRYLTNA
FT                   DGIILLLDPLQMPGARDSAAPGTALPGEDGIDPPINVLSRVSGMLLAAQGGKAAKVDTP
FT                   IAVVFSKMDAFWHLMENGSPLRSHAPALGRFDVGDSLSVHEEVRQLLREWDGVPVDQSL
FT                   ENTFARYRYFGVSALGRSATPESRVADTGIQPYRVADPLLWLLSEFGSVPKAGRGR"
     atggccagac gactcacctg cccctactgc tacgagacct tcgccccgcg tgagatccgc        60
     ttccgctgca acagccggct cagccgcacc cgtaagcagt gccagcgccg ccgtgacccg       120
     gtactcgacg aacgcttcgg caggcgcccc agccacgacg tgggcccgga cttcgccgcc       180
     gacggccgca agtcgacggc ggtgtgcccg gactgcgacg gcgagacgac gtaccgcatc       240
     tgcccggtct gccatgtcga actgccggtg cagttcggga tggtggagaa ccggctgatc       300
     gcgatggtgg gcgcgagatc gtccggcaag acgatctaca tgaccgtgct gctgcacgag       360
     atgcgccaca agatcggcga ggctttcggc gcttcgctga tgggcctgga cgacaccacc       420
     atgcgccgct acagctcgga gtacgaggac cggctctacc gcgaccggca gatgtttccg       480
     cccacgcaga ccgcgacgac caacgccaac cgggtggaac cgctggtgtt caggttcggg       540
     ctgcgccgca gggggctgtt cggggagcgg ccgcagcaca gcgtgctgtc gttcttcgac       600
     acggcgggcg aggacttcaa cagccgggag agcgtggagc tgaacacccg gtatctgacc       660
     aacgcggacg gcatcatcct gctgctcgac ccgctgcaga tgccgggcgc ccgggacagc       720
     gcggcgcccg gcacagcgct gccgggcgag gacggcatcg acccgccgat caacgtgctg       780
     agccgggtga gcggcatgct gctggccgct cagggcggca aggcggcgaa ggtcgacacc       840
     ccgatcgcgg tggtcttctc caagatggac gccttctggc atctgatgga gaacggcagc       900
     ccgctgcggt cgcacgcacc cgcgctcggc cgtttcgacg tcggcgacag cctcagcgtc       960
     cacgaggagg tgcgtcagct gctcagggag tgggacggcg tgcccgtcga ccagtccctg      1020
     gagaacacct tcgcccgcta ccgctacttc ggcgtctccg cactgggccg cagcgccacg      1080
     cccgagtccc gggtcgccga caccggaatc cagccctacc gggtcgcgga tccgctgttg      1140
     tggctgctga gcgagttcgg gtcggtgccg aaggcgggcc gcggacgatg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page