(data stored in ACNUC7421 zone)

EMBL: CP002047.PE53

CP002047.PE53        Location/Qualifiers
FT   CDS_pept        complement(50099..50713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00053"
FT                   /product="putative transcriptional regulator, XRE family
FT                   protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03174"
FT                   /db_xref="GOA:D7BUI3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI3"
FT                   /protein_id="ADI03174.1"
FT                   /translation="MGLMDPKTDDDVLDAVGPRLRALRRDRGITLADLAATTGVSESTL
FT                   SRLESGQRRPSLELLLPLARIYGVPLDDLVGAPRTGDPRIHLKPIRRYGMTFVPLSRRP
FT                   GGVHAFKMIIPARPEPLEPTPQTHEGFEWLYVLNGHLRLVIGERDLTLPPGEAAEFDTS
FT                   LPHWLGSADGGVVELLILFGLQGLRAHVRTDPHRPSQAEPQ"
     atgggcctca tggaccccaa gacggacgac gacgtactcg acgctgtggg gccgcggctc        60
     cgtgcactgc gtcgtgaccg cggcatcacc ctcgccgacc tcgccgcgac gaccggcgtg       120
     tcggagagca ctctgtcgcg gctggagagc gggcagcgcc ggccgagcct ggaattgctg       180
     ctgccactgg cccggatcta cggcgttccg ctggacgacc tcgtcggtgc cccgcgcacc       240
     ggcgaccccc ggatccacct caagccgatc agacggtacg gaatgacctt tgtgcccctg       300
     tcccggcgac cgggcggggt gcacgccttc aagatgatca tccccgcccg gccagaaccg       360
     ctcgaaccga ccccgcagac ccacgaaggc ttcgaatggc tctacgtgct caacggccac       420
     ctgcgactcg tgatcggcga gcgcgacctg acgttgccgc ccggtgaggc agccgagttc       480
     gacacgtcct tgccgcactg gctgggcagc gccgatggcg gcgtggtcga gcttctcatc       540
     ctgttcggcc tgcaagggct gcgtgcgcac gtacgcaccg accctcatcg gccgtctcag       600
     gccgagcccc agtga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page