(data stored in ACNUC7421 zone)

EMBL: CP002047.PE530

CP002047.PE530       Location/Qualifiers
FT   CDS_pept        complement(625486..627171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00530"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03651"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G0"
FT                   /protein_id="ADI03651.1"
FT                   /translation="MLGIAIGHRIARFGRLGPEGRPTVTATDLAGTDGVADPATALTTL
FT                   LAEVTGEEAVATGEEAVLGLPASAGREAEADLRRAAKDAGLRVNRIVPEPVAVALHYGA
FT                   IDEGVHRTVLVVDQAATTVDLTVLAITPDLTVRIVTTRTEQLADDHALTAIAQELTEAA
FT                   PDAVLLSGDLYTTPAHRTDIENLADVQGLTMRCRAPELAVVHGLLLLEDFGLLRIATGP
FT                   APARAHFPPPLEDPEPQPWPTPAVDPEPQNAPPDNALKGRGAMTAPPRGREQPPPPDSE
FT                   PLTATGPNGRGAVTAPPRGPERPPPPHSEPPTATTPPIPTPEPEPEPELELETPRREPA
FT                   PTLRSVPVTQLEAIRRDDHLLVLWAWPDSALTARVRWRREDVTTAGDGPRDGDIRCQRR
FT                   VYEHDGGLDLPVGRGAVTLTVEALVPDPAVDTEGAASLRIPAEPPIVEYEPSLRRRLTG
FT                   ARVATVTFTARTGCDLPALRIVHGLGRYRPTSTAEGTVLHEVPAQRLPAGAPLIVEFPL
FT                   PSTKGPSWLVCFPVDGPDSGPDSGQDHDIDIDIRPTALHRLRVT"
     atgctcggca tcgccatcgg ccaccgcatc gcccgcttcg gccggctcgg cccggaaggc        60
     cgcccgaccg tgacggcgac ggacctggcc ggaacggacg gagtcgccga ccccgccacc       120
     gcactgacca cgctccttgc cgaagtcacg ggtgaggagg cggtagccac gggtgaggag       180
     gcggtgctcg gcctgccggc ctccgccggc cgcgaggccg aggccgacct ccgccgcgcc       240
     gccaaggacg ccggcctccg cgtcaacaga atcgtcccgg aaccggtcgc ggtggccctg       300
     cactacggcg cgatcgacga gggcgtacac cgcacggtgc tggtggtcga ccaggccgcg       360
     accacagtgg acctgacggt cctcgccatc accccggatc tgacggtacg catcgtcacc       420
     acgcgcaccg aacaactggc cgacgaccac gccctcacgg cgatagccca ggaactgacc       480
     gaggcagccc cggacgccgt actcctctcc ggcgacctgt acacaacgcc cgcccaccgc       540
     acggacatcg aaaacctcgc cgacgtccag ggtctgacga tgcgctgccg ggccccagag       600
     ctggccgtcg tacacggcct cctgctcctg gaagacttcg gcctcctgcg catagccacc       660
     ggtccggcac cggcgagggc ccactttccc cctcctttgg aggacccgga accgcaaccc       720
     tggcccactc cggcggtgga tcccgaacca cagaacgccc cacccgacaa cgctctgaag       780
     gggcgcgggg ccatgacggc tccgccgcgt gggcgcgagc aacccccacc gcccgacagc       840
     gaaccactca ccgcaaccgg acccaacggg cgcggggctg tgacggctcc gccgcgtggg       900
     cccgaacgac ccccaccgcc ccacagcgaa ccacccaccg cgaccacccc acccatcccc       960
     acacccgaac cagaacccga acccgaactc gaactcgaaa cgccgcgacg ggaaccggcc      1020
     cccaccctcc gctccgtccc ggtgacccaa ctcgaggcca tccgccgaga cgaccacctc      1080
     ctcgtcctct gggcctggcc cgactccgcc ctcaccgctc gcgtccgctg gcgccgcgag      1140
     gacgtgacca cggccggcga cggccctcgc gacggcgaca tccgctgtca gcgccgggtc      1200
     tacgaacacg acggcggcct ggacctcccc gtcggccgag gcgcggtcac gctcaccgtc      1260
     gaggccctgg tccccgaccc cgccgtcgac accgagggcg ccgcctccct gcgcatcccg      1320
     gccgagcccc ccatcgtcga gtacgagccc tccttgcgcc gccgcctcac cggcgcccgc      1380
     gtcgcgaccg tcaccttcac cgcccggacc ggctgcgacc tccccgccct ccggatagtc      1440
     cacggcctcg gccgctaccg ccccaccagc acggccgagg gcaccgtcct ccacgaggtc      1500
     cccgcccagc gcctccccgc cggcgccccc ctcatcgtgg agttccccct ccccagcacc      1560
     aaaggcccct cctggctcgt ctgcttcccg gtggacggcc ccgactccgg ccccgactcc      1620
     ggccaagacc acgacatcga catcgacatc cgccccacgg cgctgcaccg gctgcgagtg      1680
     acctga                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page