(data stored in ACNUC7421 zone)

EMBL: CP002047.PE531

CP002047.PE531       Location/Qualifiers
FT   CDS_pept        complement(627176..629179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00531"
FT                   /product="ATPase AAA-2"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03652"
FT                   /db_xref="GOA:D7C0G1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G1"
FT                   /protein_id="ADI03652.1"
FT                   /translation="MDDPVNTVDFTKDEDGTGPVTADGMMPLWAVSLGWELRRGRQVIL
FT                   NGQIRDRWWFEDRPVTFRELVAGVLEARGADVVGWWDPVAGLTFPLPGHAERFAQLDAD
FT                   RPRAATRSDGRDTPADNGRGTPRDTPANDRPRTTPRGRGGSERERDRSSLLSPRPAGPP
FT                   RAFDDVVATVHRLAASPDAATAFVFQDVDHHLPPGQMESNPGYLRLRAAMTDAVTPRPT
FT                   PAGRRPHARNAVLCAVGDVGRLPGWFHLEDPRIATLHIGPPDPSERRLWLTWLRGDFNG
FT                   APDATRHDIEALVGATDGMSGWDIDALARTSWLRDAPLQKPDKLLELHRLNVSVDPWTQ
FT                   LDRETVARAADVLGARVVGQSKAVDAVAAALQAAFVGIDFGGSGTARPRGAFFFVGPTG
FT                   VGKTELAKAVAELMFGDQSAYARFDMSEYQQEHAAERLAGAPPGFIGHEQGGELTRRVQ
FT                   ERPFSVLLFDEIEKAHPRVLDKFLQILEDGRLTDGRGQTAYFSQCLIIFTSNTGAEAVQ
FT                   DLLSEGDEEVPYSVLEAHFTRAVEEKFRAMGRPEIYGRLKPGVVVFDMLRRAHIVKIAD
FT                   RLLGQLTESVRERHQAELVADTDTLHPWITERMSDPEHQAYGGRQIRNELERLRAAVVS
FT                   HFLAHRPTPGSRIRLGIEDDGTPWVRTEEGNG"
     gtggacgacc ccgtgaacac ggtcgacttc accaaggacg aggacggtac ggggcccgtc        60
     accgccgacg gcatgatgcc cctgtgggcg gtgtcgctcg gctgggagct gcgccgcggc       120
     cgccaagtga tcctcaacgg gcagatccgg gaccgctggt ggttcgagga ccggcccgtc       180
     accttccggg agctggtcgc cggggtgctg gaggcgcgcg gcgccgatgt ggtgggctgg       240
     tgggacccgg tggccgggct caccttcccg ctgccgggcc acgcggagcg cttcgcccag       300
     ctggacgcgg accggcctcg cgcggccacc agaagcgatg gccgggacac ccccgcggac       360
     aacggccggg gcacaccccg ggacaccccc gcgaacgacc ggccaaggac cactccgcgc       420
     ggccggggcg gcagcgaacg cgagcgggac cggtcgagcc tgctctcccc tcgcccggcc       480
     ggcccgccgc gcgccttcga cgacgtggtc gccaccgtgc accgactcgc cgcctcgccc       540
     gacgcggcca cagccttcgt cttccaggac gtcgaccacc acctcccgcc cggccagatg       600
     gaatcgaacc ccggctacct ccggctgcgc gccgcgatga cggacgccgt gacgccccgc       660
     ccgaccccgg cgggccgccg cccgcacgcc cgcaacgccg tcctgtgcgc ggtgggcgat       720
     gtcggccggc tgcccggctg gttccatctg gaggaccccc ggatcgccac cctgcacatc       780
     ggcccaccgg acccgagcga gcgccgcctg tggctgacct ggctgcgcgg cgacttcaac       840
     ggcgccccgg atgccacccg ccacgacatc gaggccctgg tcggcgcgac cgacggcatg       900
     tccggctggg acatcgacgc gctcgcccgg acctcgtggc tgcgcgacgc acccctgcag       960
     aaaccggaca agctcctgga actgcaccgg ctcaacgtga gcgtcgaccc gtggacccag      1020
     ctggaccggg agaccgtcgc ccgcgcggcc gacgtactgg gcgcccgcgt ggtcggccag      1080
     tccaaagccg tcgatgcggt ggccgccgcg ctccaggcgg ccttcgtggg catcgacttc      1140
     ggcggttccg gcaccgcccg ccccaggggc gcgttcttct tcgtcggccc gaccggcgtc      1200
     ggcaagaccg aactcgccaa ggccgtggcc gagttgatgt tcggtgacca gagcgcgtac      1260
     gcccgcttcg acatgagcga gtaccagcag gaacacgcgg ccgagcggct cgcgggcgca      1320
     ccgcccggct tcatcggcca cgagcagggc ggcgagctga cccgccgagt ccaggaacgg      1380
     ccgttcagcg tgctgctctt cgacgagatc gagaaggcgc acccccgggt actggacaag      1440
     ttcctccaga tcctcgagga cggccgcctc accgacggcc gcggccagac cgcgtacttc      1500
     tcccagtgcc tgatcatctt cacctccaac acgggcgcgg aggcggtcca ggatctgctg      1560
     tccgaaggcg acgaagaagt gccgtactcc gtcctggagg cacacttcac ccgggctgtg      1620
     gaggaaaagt tccgggccat gggccggccg gagatctacg gtcggctcaa gccgggcgtg      1680
     gtcgtcttcg acatgctgcg ccgcgcgcac atcgtgaaga tcgccgaccg gctgctcggc      1740
     cagctcaccg agtccgtccg cgaacgccac caggccgagc tggtcgccga cacggacacc      1800
     ctgcacccct ggatcaccga gcggatgagc gacccggagc accaggcgta cggcggccgc      1860
     cagatccgca acgaactgga gcggctgcgg gcggccgtgg tcagccactt cctggcccac      1920
     cgcccgaccc cgggcagccg gatccggctc ggcatcgaag acgacggcac accgtgggtc      1980
     aggaccgagg aagggaacgg ctga                                             2004
//

If you have problems or comments...

PBIL Back to PBIL home page