(data stored in ACNUC7421 zone)

EMBL: CP002047.PE532

CP002047.PE532       Location/Qualifiers
FT   CDS_pept        complement(629164..630597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03653"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G2"
FT                   /protein_id="ADI03653.1"
FT                   /translation="MSGSPKYSSVRVGAVYAQREAAERRRRAEQRRARERRRAAERARL
FT                   AQEAAARRERARAETERRRAEAARKEAEVAARRTAERGARLAQARAEESRADERGLDEV
FT                   WELIAEAQRSGARAETGSLERQLAELRGRAARGEQLGDAVEELRGRVVNLRPTAAGDRT
FT                   DDSAAVLAGLERRFSATGPDGAALDADGHRRCTDLLDQLRAAAGPGRQVRFEALLGTVE
FT                   HALARHAATVSEAREATVRQARAEQEREAAEAAERERAEAAEAALELALAEAAERFDVV
FT                   RPAAEGVLDTAAELGDPGLADEIGDALRAVTEALTARSASEARRAVADLEGRLPDAEDR
FT                   LDELELAYQRRRDLVEALRDAMTGEGFAFEGGEDQGGSFRLHFTRPTGATYETTVASED
FT                   DGTPVLVYHVEGEPDVTLYAPQDEAVCDTTEALLERVHEALGGDDGFVPGELTWDGKPP
FT                   PGTGGNQLPGGTSGRWTTP"
     atgagcggat cacccaagta cagcagcgtg cgcgtcggcg ccgtgtacgc ccagcgggaa        60
     gcggcagagc gccggcgccg ggccgagcag cgccgggcca gggaacgcag gcgggcggcc       120
     gagcgggccc ggctggccca ggaggcggcc gcccgccggg agcgcgcccg cgccgagacg       180
     gagcggcgcc gggccgaagc cgcccgtaag gaagccgagg tggcggctcg ccggacagcc       240
     gagcgcggcg cccggctggc ccaggcgcgg gcggaagagt cccgggccga cgagcgcggt       300
     ctcgacgagg tgtgggagct gatcgccgag gcccagcggt ccggggctcg ggccgagacc       360
     ggttccctgg agcggcagtt ggccgagttg cgtgggcggg ccgcccgtgg ggaacagctc       420
     ggggacgcgg tggaggaact gcgcggccgg gtcgtgaacc tgcgcccgac cgcggccggg       480
     gaccgtacgg atgacagcgc cgccgtcctg gccggcctgg agcgccggtt ctccgccacc       540
     ggcccggacg gcgccgccct cgacgcggac ggccatcggc gctgcaccga cctgctcgac       600
     cagctgcgtg cggctgccgg cccggggcgg caggtccgtt tcgaagccct gctcggcacg       660
     gtcgaacacg ccctcgcccg gcatgcggcg acggtctcgg aggcgcggga agccaccgta       720
     cggcaggccc gcgcggaaca ggagcgcgag gcggcggagg cggcggagcg cgagcgcgcc       780
     gaggcggcgg aggcggccct ggagctggcc ctcgcggagg ccgccgagcg gttcgacgtc       840
     gtacgtccgg cggccgaggg cgtgctggac accgccgccg aactcggcga ccccggcctc       900
     gccgacgaga tcggggacgc cctgcgcgcc gtcaccgagg cgctgaccgc gcggtcggcg       960
     agcgaggccc ggcgggcggt cgccgatctg gaaggccggc tccccgacgc cgaggaccgg      1020
     ctggacgagc tggagctggc ctaccagcgg cgccgggacc tggtggaggc gctgcgggat      1080
     gccatgaccg gcgaggggtt cgccttcgaa ggtggtgagg accagggggg ctccttccgg      1140
     ctgcacttca cgcggccgac cggggcgacg tacgagacca cggtcgcctc cgaggacgac      1200
     ggcacgcccg tcctcgtcta ccacgtggag ggcgagccgg acgtgacgct gtacgcccca      1260
     caggacgagg cggtgtgcga caccaccgag gcgctgctgg agcgggtgca cgaggcgctg      1320
     ggcggcgacg acggcttcgt accgggcgag ctgacctggg acggcaaacc gccgccgggc      1380
     acgggcggca accagctgcc cggcggcacc tccgggcggt ggacgacccc gtga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page