(data stored in ACNUC7421 zone)

EMBL: CP002047.PE533

CP002047.PE533       Location/Qualifiers
FT   CDS_pept        complement(630594..631238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00533"
FT                   /product="putative radical activating enzyme"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03654"
FT                   /db_xref="GOA:D7C0G3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G3"
FT                   /protein_id="ADI03654.1"
FT                   /translation="MTTHLSVARTLDRCTVLGPATRAVIWVQGCPLRCQGCVAAETLPF
FT                   EGGTSRSVAELADWLCRLDGIEGVTFSGGEPFSQAGALAELLDAVRERRPDFGAMAYSG
FT                   FRHEALRRGDPDRLALLERLDLLVDGPYRAPLHGSLRWRGSENQRLIPLTDRYTRALAE
FT                   PDTTAGIELSVDADGSLSWAGVPPTPGFREGLEKQLAARGFVLHTEARRER"
     atgacgaccc acctctccgt cgcccggacg ctggaccgct gcacggtcct cggccccgcc        60
     acccgagcgg tcatctgggt acagggctgc ccgctgcgct gccagggctg tgtggccgcg       120
     gagaccctgc ccttcgaggg cggcaccagc cgctcggttg ccgaactcgc cgactggctg       180
     tgccggttgg acggcatcga gggcgtcacg ttctccggcg gtgagccgtt cagccaggcc       240
     ggggcgctgg ccgaactgct cgacgcggta cgggagcggc gtccggactt cggcgccatg       300
     gcgtactccg gcttccgcca cgaggcactg cggcgcggcg acccggaccg gctcgccctg       360
     ctggaacggc tggacctgct ggtcgacggg ccgtaccggg cgccgctcca cggcagcctg       420
     cgctggcgcg gctcggagaa ccagcggctg atcccgctca ccgaccgcta cacacgggcc       480
     ctggccgagc cggacacgac cgcggggatc gaactgtcgg tggacgccga cggatcgctc       540
     tcctgggccg gggttccgcc gacccccgga ttccgggaag ggcttgagaa gcagctcgcg       600
     gcgcgggggt tcgtgctgca caccgaggca cggagggaac gatga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page