(data stored in ACNUC7421 zone)

EMBL: CP002047.PE534

CP002047.PE534       Location/Qualifiers
FT   CDS_pept        complement(631235..632317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00534"
FT                   /product="hypothetical protein"
FT                   /note="COG4248 Uncharacterized protein with protein kinase
FT                   and helix-hairpin-helix DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03655"
FT                   /db_xref="GOA:D7C0G4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G4"
FT                   /protein_id="ADI03655.1"
FT                   /translation="MTVGLTVVSGSGHTWRLTEQIGSGAEGFVYGVDDGRPLVAKLVPD
FT                   PPDPEAYRRRVARLVRQRREPRTVGLLSGTPVRLAWPLVPVRTGGGTGSDRVDGYVMTD
FT                   MRHAYQPFSRLLTVSTRTAFLPRATWATALHAARALARLLGELHTEGYVVGDLKPDNLW
FT                   VDETGRVGMADVDSWQFTDGREVFPGRMRTPGYTAPERIGAPAGTPPDTASDEFALAVL
FT                   VHQLLMAGLHPFAGHPADGGDYLSYDDNVAHGRCRIVDRTSVLLPRSVPPADLLPRRLA
FT                   ELFRTAFGPARRRPTAAEWAQALAAELAPGRLKACAVNARHLHTVERPWCPWCDQAERG
FT                   ADSYPGGGADGHPGRPQEEA"
     gtgaccgtgg gactgacagt ggtgtccggc agcggacaca catggcggct caccgagcag        60
     ataggcagcg gcgcggaggg gttcgtgtac ggcgtcgacg acggccgccc cctcgtcgcg       120
     aaactcgtcc ccgacccgcc cgaccccgag gcctaccggc gccgcgtggc ccgcctggtg       180
     cgccagcgcc gcgaaccccg caccgtcggc ctgctctccg gcacacccgt ccggctggcc       240
     tggccactgg tcccggtacg cacgggcggc ggcaccggct cggaccgagt cgacggttac       300
     gtgatgaccg acatgcgcca cgcctaccag ccgttcagcc gcctcctcac cgtctccacc       360
     cgcactgcct tcctgccccg ggcgacctgg gccaccgccc tccacgccgc ccgcgccctc       420
     gcccggctgc tgggcgaact gcacaccgag ggctatgtgg tgggcgacct caagcccgac       480
     aacctctggg tcgacgagac cggccgggtc ggtatggcgg acgtcgactc ctggcagttc       540
     acggacggcc gtgaggtctt cccgggccgg atgcgcactc ccggctacac cgcccccgag       600
     cggatcggcg ccccggccgg tacgccaccg gacaccgcgt ccgacgagtt cgccctggcc       660
     gtcctggtcc accagctcct catggccggt ctgcaccctt tcgccgggca cccggcggac       720
     ggcggcgact atctgtcgta cgacgacaac gtggcgcacg gccgctgccg gatcgtcgac       780
     cgtacgtcgg tactgctgcc ccgctccgtg ccgcccgccg acctgctgcc gagacggctc       840
     gcggagctgt tccggacggc gttcggaccc gcgcgccgac gcccgacggc ggccgagtgg       900
     gcccaggcgc tcgcggccga gctggcaccg ggccggctga aggcgtgcgc cgtgaacgcc       960
     cgccacctcc acaccgtcga acggccgtgg tgcccgtggt gcgaccaggc cgagcgtggc      1020
     gccgacagct accccggcgg gggcgccgac ggccaccctg gccggccgca ggaggaagca      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page