(data stored in ACNUC7421 zone)

EMBL: CP002047.PE535

CP002047.PE535       Location/Qualifiers
FT   CDS_pept        complement(632314..633084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03656"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G5"
FT                   /protein_id="ADI03656.1"
FT                   /translation="MIVAGVSVQGTAHLAAGQGCQDAFKAIDLGDTAVLAVSDGASSRD
FT                   RSALGAHIAVDAACRLLTEDIPGAEETPEAWTRWIAGRGQRVVEEYLRAVSGVLGTEPG
FT                   AAEPGALAATLTAAVVAPPWVAFVSIGDGFGTLLTRDERCHLVLPPPTGPPVFLSSPGA
FT                   ALRIRTFVAWEPELGGVVLATDGCAALTLDHPSVRQLPPETGPLPAERFFLGLAATLRQ
FT                   NHGDAEPLRHRLSGPEAGRTGDDLTVLCALVEGG"
     gtgatcgtcg cgggcgtctc cgtccagggc accgctcatc tcgccgccgg gcagggctgc        60
     caggacgcgt tcaaggcgat cgacctgggc gatacggcgg tcctggcggt gtccgacggc       120
     gcgagcagcc gcgaccgcag cgccctgggc gcccatatag cggtcgacgc ggcctgccgc       180
     ctgctgacgg aggacatccc gggcgcggag gagacgccgg aggcgtggac ccggtggatc       240
     gcggggcgcg ggcagagggt ggtcgaggag tatttgcggg cggtgtcggg ggtgttgggc       300
     acggagccgg gtgcagcgga gcccggcgcc ctggcggcca ccctcaccgc ggcggtcgtg       360
     gccccgccct gggtggcctt cgtctcgatc ggggacggct tcggcaccct tctgacccgc       420
     gacgaacgct gccacctggt cctccccccg cccaccggtc cacccgtctt cctctcctcg       480
     cccggtgcgg ccctccgcat ccgcaccttc gtcgcctggg agccggaact cggcggagtg       540
     gtcctggcca ccgacggctg cgccgccctc accctcgacc acccctccgt ccgccaactc       600
     cccccagaga cgggcccctt accggccgag cgcttcttcc tcggcctcgc cgccacgctc       660
     cgccagaacc acggagacgc cgagcccctt cggcatcggc tctccgggcc ggaggccggc       720
     cggaccggtg acgatctgac cgtcctgtgc gctctcgtcg aaggggggtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page